KEGG   Bacillus pumilus SAFR-032: BPUM_1723Help
Entry
BPUM_1723         CDS       T00599                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00260  Glycine, serine and threonine metabolism
bpu00750  Vitamin B6 metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01230  Biosynthesis of amino acids
Module
bpu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPUM_1723
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPUM_1723
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPUM_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP FAIM1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ABV62397
UniProt: A8FDT0
Position
complement(1771649..1772752)
Genome map
AA seq 367 aa AA seqDB search
MNQLICHHCGKKYEMTPTLWKCDCDGVLNLVKDTPKIDVAAWNHYPNSLWRYVETMPFSK
GSNTWETVTMGEGQTPLIVLDPHEPNTYVKVDYMMPTLSFKDRGAAVLMTHAKELGVSKV
IADSSGNAGTAIAAYAARCGIACDIYLSDDTSPKKVAQIKAHGATIKEIHGTREDIAAAA
QKAVDNEKVFYASHVYNPYFFEGTKTYAYEIYEQLNGAPDTLIIPVGNGTLLLGAYDGFK
ELFENGLILKIPKIIAIQAKNCAPLVKAYQNEEKSASPVTNKGTLAEGIAIAAPARSKQI
LEAVQDTNGTFIDIEEDEILNARSKLSEKGFYVEVTSAVNLAGYMKYQKKPEETIVIPLC
GAGIKSK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattaatttgtcaccattgtgggaaaaaatatgagatgacaccaactctatgg
aaatgtgattgtgatggcgtattaaatctagtgaaagataccccgaaaatagacgtcgca
gcatggaatcactatccaaactccttatggcgttatgttgaaaccatgccattttcaaaa
ggttctaacacttgggaaacggtcacaatgggggaggggcaaacccctttaatcgtactt
gatcctcatgagccaaacacttatgtaaaagttgattatatgatgccgacattatccttt
aaagaccgaggagccgctgtattgatgacacatgcaaaagaattaggggtatcaaaggtg
attgctgatagtagtgggaatgcaggaacggcgattgcagcttatgcagcacgttgcggt
atcgcctgtgacatctatctaagcgatgacacttcacccaaaaaagtcgctcaaatcaaa
gcccatggcgcaacgattaaagaaattcacgggacgcgagaggacattgcagctgcagca
caaaaggcagtagacaatgaaaaggttttttatgcaagtcatgtctataacccttatttt
tttgaaggcactaaaacatacgcctatgaaatctatgaacaactaaatggagcacctgat
actttaatcattccggttggcaacggtactctcctcctaggggcgtatgatggttttaaa
gagttatttgaaaatggtttgattcttaaaataccgaaaatcattgccatacaagcgaaa
aactgtgcacctcttgtgaaagcttatcaaaatgaagagaaatcagcatcgcctgtcaca
aataaagggaccttagcagaagggatagccattgctgccccggcgcgctctaaacaaatt
ttagaagctgtacaagataccaatggtacatttatagatattgaagaagatgagatattg
aatgctcgctctaaattaagtgagaaaggattttatgtcgaagtgacctcagcagtcaat
ttggctggctacatgaaatatcaaaagaaaccagaagaaaccattgtcatacctctttgt
ggtgcagggataaaatcaaaataa

DBGET integrated database retrieval system