KEGG   Bacillus pumilus SAFR-032: BPUM_1808Help
Entry
BPUM_1808         CDS       T00599                                 

Definition
(GenBank) pectin esterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00040  Pentose and glucuronate interconversions
bpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPUM_1808
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     BPUM_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: ABV62479
UniProt: A8FE12
Position
complement(1860569..1861549)
Genome map
AA seq 326 aa AA seqDB search
MKYGKVWLVIALSLLLLNSASLQAAGHQNQTNRVLVVDQKGNGSFRTVQSAIDAIPANNQ
QRVTIYIKNGVYKEKILLPQNKPYVSLIGEDQDNTILTYNDTNASTGSTTNSSSTMIRAN
DFYAENITFQNTAGRYAGQAVALYVSGDRATFKQIRVLGYQDTLYATGTGRQYYENCYIE
GTVDFIFGSATAVFKRAEIKSLGNGYITAASTTESQKYGYVLIDSTLQKGTAAAQSVYLG
RPWRPHSAVTFLNTKMDHHIKAEGWHNWDNRDNERTARYKEYGSTGAGSNLTNRVKWSSI
LTKNEASQITVQAVLGGADGWNPEKR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatggaaaggtatggcttgtgatcgccttgtctttattactattgaactcagct
tcacttcaagcagccggacatcagaatcaaacaaatcgcgtccttgtggttgatcaaaag
ggaaatggctcgtttcgaaccgttcagtctgccattgatgcgattccagcaaataatcaa
cagcgcgtcacgatctatattaaaaatggtgtgtataaagagaaaatcctgcttccgcaa
aataaaccttacgtgtccttgatcggggaagaccaagacaatacgattctgacctataat
gatacaaatgcaagtactggcagcacaacaaatagttcaagcacaatgattcgtgcgaac
gacttttatgcggaaaatattacctttcaaaatacggcgggcagatatgctggtcaggcg
gttgcactgtacgtttctggtgaccgggctacgttcaaacaaatacgtgtcttaggatat
caagatacactttatgcaacgggtacaggccggcaatattatgaaaactgctatattgaa
ggtacggtcgattttatttttggatcagctacagccgtgtttaaaagagctgaaataaaa
agtcttggaaatgggtatattactgcagcatccacaacagaatctcaaaaatatggctat
gtattaattgattctacgctgcaaaaggggacggctgctgctcaatcggtttatttagga
cgtccgtggaggcctcattctgctgtgacattcctcaatacaaaaatggatcatcatata
aaggcagagggctggcataactgggataaccgcgataacgaaagaacagcaagatataaa
gaatacggatcgacaggggcaggaagcaatttgacaaaccgcgtaaaatggtccagcatt
ttaacgaaaaacgaagcaagtcaaatcaccgtgcaagctgttcttggcggagccgatggc
tggaatccagaaaaaaggtaa

DBGET integrated database retrieval system