KEGG   Bacillus pumilus SAFR-032: BPUM_1994Help
Entry
BPUM_1994         CDS       T00599                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00260  Glycine, serine and threonine metabolism
bpu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01130  Biosynthesis of antibiotics
bpu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPUM_1994
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPUM_1994
Enzymes [BR:bpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPUM_1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABV62664
UniProt: A8FEJ7
Position
complement(2043573..2044376)
Genome map
AA seq 267 aa AA seqDB search
MITFQLEQGEKLFIPFMTAGDPSEEITIDLALSLQAAGAHAIELGVPYSDPLADGPVIQR
ASKRALNHGMNIVKAIELAGKMKKNGVKIPVILFTYYNPVLQLDTEYFFALLRKNHISGL
LTPDLPFEESSELQKNCQSYDISYISLVAPTSKERLVNIVEQAEGFVYCVSSLGVTGVRQ
TFDESITDFIQQVKQLSHIPVAVGFGISTREQVDSMNKLSDGVVVGSALVKKIEELHDQL
LASDTRQDALREFETYAKTFSPLYSFK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatcacttttcaattagagcaaggcgagaaattattcatcccatttatgacggcagga
gatccgtcagaagaaatcacgatcgatttagctttgtcccttcaagcagccggtgcacat
gcgattgagctaggcgttccttactccgatccgctagcagacggtcctgtcattcaaaga
gcctccaaaagagctctaaatcatggcatgaatatcgtaaaagcgatagaattagcaggg
aagatgaaaaaaaacggtgtaaaaattcctgttattctatttacgtattataatcctgtg
ttacaattagacacagaatactttttcgctttactgcgcaaaaatcatatttcgggactc
ttaacacccgacttgccttttgaagaaagcagtgagctgcaaaagaactgtcaatcatat
gacatttcatatatttcgctcgttgcaccaaccagtaaggaacgattagtaaatattgta
gagcaggcagaaggttttgtgtattgtgtttcatctcttggtgtaacaggtgtcagacaa
acctttgacgaatcgattactgattttattcaacaagtgaaacagctgagtcacataccg
gttgcggtcggttttggtatctcaacaagagagcaggtagactcaatgaataaactgagt
gacggtgtcgttgtaggcagtgcacttgtgaaaaaaattgaagaacttcacgatcaattg
ttagcaagtgatacacgtcaagacgctttaagagaatttgaaacctatgcaaaaacattt
agtcccctctattcattcaaatga

DBGET integrated database retrieval system