KEGG   Bacillus pumilus SAFR-032: BPUM_2347Help
Entry
BPUM_2347         CDS       T00599                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BPUM_2347
Enzymes [BR:bpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BPUM_2347
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BPUM_2347
    1.1.1.-  
     BPUM_2347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP ADH_N_assoc F420_oxidored ApbA
Motif
Other DBs
NCBI-ProteinID: ABV63013
UniProt: A8FFJ6
Position
complement(2355660..2356700)
Genome map
AA seq 346 aa AA seqDB search
MKALRWHDQKDIRLEEIDEPKVAPGKVKLKVKWCGICGSDLHEYLGGPIFIPVNEPHPLT
KEKAPITLGHEFSGEVVEVGEDVSNYKVGDRVVVEPIFATHGHQGAYNLDENMGFLGLAG
GGGGFSEYVSVDEELLHLLPDEISYEQGALVEPSAVALYAVRSSKVQAGDTAAVFGCGPI
GLLVIEALKAAGATDIYAVELSKERQEKAKELGAIIVDPSQYEDVVQEIARRTNGGVDVS
FEVTGVPVVLKQAIQSTRISGETVIVSIWEKGAEILPNDIVIKERTVKGIIGYRDVFPSV
LNLMRKGYFSADTLVTKKIKLDDVIEDGFHALINEKDQVKILVSAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactacgctggcacgatcaaaaggacattcgactagaggaaattgatgaacca
aaagttgctccaggaaaagtgaaacttaaagtgaaatggtgcggcatttgtggtagtgat
ttacatgaatatctaggaggacctatcttcattccagtgaatgaacctcatccactgaca
aaagaaaaagcacctattacactggggcatgaattttctggtgaggttgttgaagtagga
gaagacgtgagcaattacaaagtaggcgaccgagtggttgttgagccgatttttgcaact
cacggacatcaaggtgcttacaacttagatgaaaatatgggctttttaggacttgccgga
ggcggcggtggattctctgaatatgtatctgtcgatgaagaattacttcatttattacca
gacgaaatttcatatgagcaaggggcacttgtagagccttcagcagttgctctatatgca
gttcgttctagtaaagtacaagctggcgatacagcggctgtgtttggatgcggaccaatt
ggcttacttgttattgaagcattaaaagcagctggtgctactgatatttacgcggtagaa
ttatctaaagaacgccaagaaaaagcgaaagagcttggagcgatcattgttgatccttct
caatatgaagatgttgttcaagaaattgcacgccgtacaaatggtggcgtcgatgtttct
tttgaagtgacaggtgtacctgttgtattgaagcaagcaatccaatcaactagaatttca
ggtgaaacagtcattgtaagtatttgggaaaaaggcgcagaaattctgccaaatgacatt
gtcattaaagaacgtacagtcaaaggaattatcggctacagagacgtattcccatctgta
ttaaacttaatgagaaaaggatatttctctgcagatacgctcgtcacgaagaaaatcaag
ttggacgatgtaatcgaagatggtttccatgctttaatcaatgaaaaagatcaagtgaaa
attttagttagtgctgaataa

DBGET integrated database retrieval system