KEGG   Bacillus pumilus SAFR-032: BPUM_2453Help
Entry
BPUM_2453         CDS       T00599                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00860  Porphyrin and chlorophyll metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPUM_2453
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpu01007]
    BPUM_2453
Enzymes [BR:bpu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BPUM_2453
Amino acid related enzymes [BR:bpu01007]
 Aminotransferase (transaminase)
  Class III
   BPUM_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABV63116
UniProt: A8FFU9
Position
complement(2461803..2463095)
Genome map
AA seq 430 aa AA seqDB search
MGRSYEKSKQAFEEAQHLMPGGVNSPVRAFKSVNTDPIFMERGKGAKIYDIDGNEYIDYV
LSWGPLILGHTNDRVVESIQRVAEKGTSFGASTLVENELAKLVSERVPSIEVIRMVSSGT
EATMSALRLARGFTGRNKIVKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGTASNT
ITVPYNDLESIQVAFQEFGDDIAGVIVEPVAGNMGVVPPQDGFLQGLRDITEQYGALLIF
DEVMTGFRVDYHCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGRADIMRQIAPSGPIYQAG
TLSGNPLAMTAGLETLKQLTPESYEEFRRKGDRLEEGISNAAKTHGIPLTFNRAGSMIGF
FFTDEEVINYDIAKNADLALFAEFYKEMADHGIFLPPSQFEGLFLSTAHTDEDIEYTIET
VEKVFQKLRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtagctatgaaaaatcaaagcaagcatttgaagaagcacagcatttaatgcct
ggtggtgtcaacagccctgtgcgtgcatttaaatcagtgaacacagatccgatttttatg
gagcgggggaaaggcgccaagatatatgatattgatgggaatgaatacatcgattatgtc
ttatcatgggggccgcttattttagggcatacgaatgaccgtgtggttgaaagcattcag
cgagttgcagaaaaggggacaagctttggtgcttccacattagttgaaaatgaattagct
aagcttgtatcagagcgggttccttctatcgaagtcattcgtatggtcagctctggtaca
gaggcaacgatgagtgcacttcgtctagctcgaggctttacaggcagaaataaaattgtg
aaatttgaaggctgctatcatggccacggggattctttgctcattaaagcaggttcaggc
gtcgcaacgcttgggcttccagatagtccaggtgtacctgaagggactgcaagcaatacg
atcacagtgccttataatgatttagaaagcattcaagttgcatttcaggagtttggggac
gatattgcaggagtgattgtcgagccggttgcaggaaatatgggcgttgtccctccgcaa
gacggtttcttacaagggctgagagatatcacagagcaatacggagccttactcattttt
gatgaggtcatgaccggcttccgtgtggattatcactgcgcacaaggctactttggcgtc
acacctgatctgacgtgtcttggtaaagtgattggtggcggtctcccggtcggtgcttat
ggcggaagagcggatattatgagacaaattgcgccaagcggtccaatttatcaagcagga
acgttatctggtaacccacttgcgatgacagcaggcttagaaaccttaaaacagctgaca
cctgagtcttacgaagagtttagacgaaaaggagaccggctggaagaaggcatttcaaat
gcggcgaaaacacacggaattccattaacgtttaaccgtgcgggttcgatgattggattc
ttctttacagatgaagaagtgatcaattatgacatagccaaaaatgctgatctcgcttta
tttgctgaattttacaaggaaatggccgatcacggtatcttccttccaccttctcaattc
gaaggactgttcctgtcaacagcccatacagatgaagacatcgaatatacgattgagaca
gtggaaaaagtatttcaaaaactacgtcgataa

DBGET integrated database retrieval system