KEGG   Bacillus pumilus SAFR-032: BPUM_2741Help
Entry
BPUM_2741         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_BhlA XhlA HVSL ThiF PRKCSH-like
Motif
Other DBs
NCBI-ProteinID: ABV63397
UniProt: A8FGN0
Position
complement(2752647..2752859)
Genome map
AA seq 70 aa AA seqDB search
MEVDVVQNLMTQGPFAVLFCWILFYVLNTTKERENKLNAQIEAQNEVLAKFSEKYDVVID
KLDKIERNLK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagatgtcgtacaaaacttaatgacacaaggcccatttgccgttctcttttgc
tggattctgttttatgttctcaacacaacgaaggaacgagaaaataagctcaatgcacaa
atcgaggcacaaaatgaagtgttagcaaagtttagtgagaaatatgacgtcgtcatcgac
aaactcgataaaattgaacggaatttaaaatag

DBGET integrated database retrieval system