KEGG   Bacillus pumilus SAFR-032: BPUM_2892Help
Entry
BPUM_2892         CDS       T00599                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00627  Aminobenzoate degradation
bpu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BPUM_2892
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BPUM_2892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: ABV63547
UniProt: A8FH30
Position
complement(2886263..2887033)
Genome map
AA seq 256 aa AA seqDB search
MKYKGYLIDLDGTMYKGTEKIEEAGQFVQKLNELNIPYLFVTNNSSRTPKQVAEKLVSFD
IPATEEQVFTTSMATANYIAEQKKDASVYVIGEEGIKQAIEEKGLTFGQEDADFVVVGID
RSMTYEKFAVGAIAIRQGAQFVSTNGDIAIPTERGLLPGNGSLTSVLTVTTTVQPTFIGK
PESIIMEQAMRVLGTDVSETLMVGDNYDTDIMAGMNAGMDTLLVHTGVTTKELLQNYDKQ
PTYVIDSLSEWIERLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaggctacttaattgatttagacggaacaatgtataaaggaacagaaaag
atcgaggaagcaggtcaatttgttcaaaagttaaacgaactaaatattccctacttgttt
gtcacgaataactcgtcacgcacgccaaagcaggtagcggaaaaacttgtttcattcgat
atcccagcaactgaagaacaagtctttacaacaagtatggcaacagccaattatattgct
gaacaaaagaaagacgcgtctgtttacgtcatcggtgaagaaggaatcaagcaggccatt
gaagaaaaagggctgacatttggtcaggaggatgctgatttcgttgtggttggaattgat
cgaagcatgacatatgaaaaattcgcagtaggtgcgattgctatccgtcaaggcgcacaa
tttgtctcaacaaatggagacattgccattccaacagaaagagggcttctgccaggtaac
ggctcattaacatctgtattgaccgtcaccacgacagttcagccaacatttatcggaaag
ccagaatccatcatcatggaacaagccatgcgggtgctcgggacggatgtgtctgagacg
ctcatggtgggtgataactatgatacggatattatggcaggaatgaatgcaggcatggac
acattgctcgttcatacaggcgtgacaacaaaagagctgcttcagaactatgataaacag
ccaacctatgtcattgattcattatctgagtggattgaacgattatcataa

DBGET integrated database retrieval system