KEGG   Bacillus pumilus SAFR-032: BPUM_3128Help
Entry
BPUM_3128         CDS       T00599                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00340  Histidine metabolism
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01230  Biosynthesis of amino acids
Module
bpu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BPUM_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ABV63782
UniProt: A8FHR5
Position
complement(3103055..3104230)
Genome map
AA seq 391 aa AA seqDB search
MFMFEKPYGMRDSLPGLYETKKKVRHSLTEVMNGWGYRLMETPTLEFYDTVGVQSAITDT
QLFKLLDQNGQTLVLRPDMTGPIARVAASKLHEQAYPLRVGYAANVFRAQEREGGRPSEF
EQVGIELIGDGSISADAEVIALVVFALKNAGLNSFKIAIGHVALAETLFVDVLGNTERAN
VLRRFLYEKNYVGYRQHVKQLPLSSIDKTRLLQLLELRGGREVTERAEEIVVSQEGKEVL
AQLKSLWETLEDYGCTEYIRLDLSMVSHMSYYTGILFEVFADHVGSVIGSGGRYDQLLAH
FNAPAPATGFGLRLDRLLEALDVKEINEPQEAVIFSKEQRLEAFAFAEKERSKGKKIVLQ
DLAGIENIDAMTKAFEQVTYFIGARKGEQNG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgtttgagaaaccgtatggtatgcgggattcattaccaggattgtatgagacg
aagaaaaaagtgagacattctttaacagaggtcatgaatggttggggttaccggttgatg
gagacaccaacgcttgaattttacgatacagtcggtgttcaatcggcgattacagataca
cagctctttaagcttttagatcagaacgggcaaaccctagtacttagacctgatatgacg
ggacctattgcgagagtagcggcatcaaagctccatgaacaggcgtatccacttcgcgtt
gggtatgcggccaatgtgttccgggcgcaggaaagagaaggcggaagaccatcagaattt
gagcaggtcggaattgagttgattggagacggttcgattagtgcagatgctgaagtgatc
gcgcttgtcgtattcgcattaaaaaatgctgggctcaattccttcaaaatcgcaattggg
catgtcgctttagcagagacgttatttgtagatgtgctgggaaatacagagcgtgcaaac
gtccttcgccgattcttatatgaaaagaattatgtaggataccgtcagcatgtgaagcaa
ttgccactctcctccatcgataaaacgaggctgttacagcttttagagttaagaggaggc
cgggaagtcacggagcgggcagaggaaatcgtcgtttcacaagaaggaaaagaggtgctc
gcgcagttaaagtcgctttgggagacacttgaagattacggctgtacggaatatatccgt
ctcgatttaagcatggtgagtcatatgagctactacacgggtattttgtttgaagtattt
gctgatcatgttgggtcagtcatcggaagtggcggtagatatgaccaattgcttgctcac
tttaatgcacctgcaccagctacaggattcggacttcgattagaccgtctgcttgaagcg
ctcgatgtaaaagaaatcaatgagccacaggaggcagtgatttttagtaaagaacaaagg
ctggaggcttttgcttttgcagaaaaggagcggtcaaaagggaaaaagatcgtgctgcaa
gacttagcagggattgaaaatattgacgcgatgaccaaggcatttgagcaggtgacttat
tttatcggcgctagaaagggagagcaaaatgggtaa

DBGET integrated database retrieval system