KEGG   Bacillus pumilus SAFR-032: BPUM_3373Help
Entry
BPUM_3373         CDS       T00599                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00071  Fatty acid degradation
bpu00072  Synthesis and degradation of ketone bodies
bpu00280  Valine, leucine and isoleucine degradation
bpu00310  Lysine degradation
bpu00362  Benzoate degradation
bpu00380  Tryptophan metabolism
bpu00620  Pyruvate metabolism
bpu00630  Glyoxylate and dicarboxylate metabolism
bpu00640  Propanoate metabolism
bpu00650  Butanoate metabolism
bpu00900  Terpenoid backbone biosynthesis
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu01120  Microbial metabolism in diverse environments
bpu01130  Biosynthesis of antibiotics
bpu01200  Carbon metabolism
bpu01212  Fatty acid metabolism
bpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPUM_3373
   00630 Glyoxylate and dicarboxylate metabolism
    BPUM_3373
   00640 Propanoate metabolism
    BPUM_3373
   00650 Butanoate metabolism
    BPUM_3373
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BPUM_3373
   00072 Synthesis and degradation of ketone bodies
    BPUM_3373
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPUM_3373
   00310 Lysine degradation
    BPUM_3373
   00380 Tryptophan metabolism
    BPUM_3373
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BPUM_3373
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPUM_3373
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BPUM_3373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpu04147]
    BPUM_3373
Enzymes [BR:bpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BPUM_3373
Exosome [BR:bpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPUM_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABV64025
UniProt: A8FIF8
Position
complement(3346221..3347396)
Genome map
AA seq 391 aa AA seqDB search
MSKTVIVSGARTPFGKLGGAFIGLTAAELGGVAIKAALERVPGSHHVDEVIMGSVLQGGQ
GQIPSRQAARHADLPWSVPTQTINKVCASGMRSVSTADQIIRAGDAEVILAGGMESMSHA
PYLLKKARWGYKMGDGAVQDAMILDGLTCSFTGVHMGEYGSMAAKELGITREEQDLWALR
SHERAIEAQKNGFFEHEITPVTVKTKTGERLITEDESPRRDTSYERLSKLMPVFNQTGTI
TAGNAPGINDGASALLLMKDTYAKQHDVKPLAVVLGHVQIAVEAKDFPKTPAFAIEKILQ
KTGKRLEDIDLFEINEAFSAVALACEKITGLDRRKMNINGGAVALGHPIGASGTRIILTL
IHALKQRGGGIGIAAICSGGGQGDAIMIKVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacggtcattgtatctggagcaagaacaccatttggaaaactaggcggtgct
ttcatcgggttgactgccgcagaactaggcggagtggcaatcaaggctgcgctggaaaga
gtgccaggttcacatcatgtggatgaggtcatcatgggaagtgttttgcagggaggacaa
ggacagattccttcaaggcaagcagcaagacatgctgatcttccgtggtccgttccgacg
caaaccatcaataaagtctgtgcatcaggtatgcgcagtgtgagcacagcagaccaaatc
atccgagctggagatgcggaggtcatcctagcgggcggtatggaatccatgtcacacgcc
ccttatttactaaaaaaagcgcgctggggctacaaaatgggagatggtgcggtacaagat
gcgatgattttagatggattaacctgttcatttacaggcgtccatatgggggagtatggg
agcatggctgcgaaggaacttggaattacgcgcgaagagcaagacctttgggcgttaaga
agtcatgaacgggcgatcgaagcgcagaaaaacggcttttttgaacatgaaatcaccccc
gtcaccgtcaagacgaaaacgggagagcggctgatcacagaagatgaatccccgcggcgt
gatacgtcatatgaacgactgtcaaagctcatgcctgtttttaatcaaacgggtaccatt
accgctggaaatgcaccaggtatcaatgatggcgcaagtgcgctacttttaatgaaagac
acatatgcaaagcagcatgatgtcaagccattggcagtcgtgcttggtcatgtgcagata
gccgtagaggcaaaggattttccaaaaacaccagcctttgctatcgagaagattttacag
aaaacaggcaagcgtctagaggatattgatctatttgaaatcaatgaggcattctcagct
gtggcgctggcgtgtgaaaaaatcacggggctggaccggcggaaaatgaatatcaatggt
ggtgcagttgcgcttggtcaccctattggggcaagcggaacacgtatcatattgaccttg
attcatgcattaaaacaaagaggtggcggtattggcattgcggcgatttgcagtggaggc
ggtcaaggagatgccatcatgataaaggtagattaa

DBGET integrated database retrieval system