KEGG   Bacillus pumilus SAFR-032: BPUM_3426Help
Entry
BPUM_3426         CDS       T00599                                 

Definition
(GenBank) spore coat protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00521  Streptomycin biosynthesis
bpu00523  Polyketide sugar unit biosynthesis
bpu01130  Biosynthesis of antibiotics
Module
bpu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bpu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BPUM_3426
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPUM_3426
Enzymes [BR:bpu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BPUM_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABV64077
UniProt: A8FIL0
Position
complement(3395891..3396346)
Genome map
AA seq 151 aa AA seqDB search
MIDGVQTKKLMKHCDDRGFFAELIRDDEPLLKRFGQASWSKSFPGVIKAFHYHEKQDDVW
FFPVGHAQVVLYDLREDSPTRRQTDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLQIVYF
TTESYDPKNPDEKRIAWNDETIGFDWETTFK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgattgatggtgtacaaacgaaaaaactcatgaaacattgtgatgatcgcggctttttt
gcagagctcattcgagatgatgagccattgctgaaacgttttgggcaggcatcgtggtcg
aaaagctttccaggagtgatcaaagcctttcattatcatgaaaagcaagatgacgtttgg
tttttcccagtaggtcatgctcaggtcgttttatacgatttgcgtgaggactctcctaca
aggaggcaaaccgatgtgtattatatgggggaagataatccaatgctgctcctcattcca
aagggtgtcgcgcatggctaccgggtactaggggagacgccgctacaaattgtctatttc
acgacagaatcctatgacccgaaaaacccagatgaaaagagaatcgcttggaatgacgaa
acaatcggatttgattgggaaacgacatttaaataa

DBGET integrated database retrieval system