KEGG   Bacillus pumilus SAFR-032: BPUM_3531Help
Entry
BPUM_3531         CDS       T00599                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00740  Riboflavin metabolism
bpu00790  Folate biosynthesis
bpu01100  Metabolic pathways
bpu01110  Biosynthesis of secondary metabolites
bpu02024  Quorum sensing
Module
bpu_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BPUM_3531
   00790 Folate biosynthesis
    BPUM_3531
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BPUM_3531
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BPUM_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ABV64177
UniProt: A8FIW0
Position
3496035..3496796
Genome map
AA seq 253 aa AA seqDB search
MDKHTDLKTAILKDKIKRVQQEDGYIYITGPIKLPVNLDGRTVMFNWYSWLKDDGLEPLS
DEALIESLSSRQLADHQQSSVLVYGDFEHADEALIRMHSICHTGDIFGSKRCDCGFQLKQ
SMRMIEDNGAGALFYLANHEGRGIGLFTKAMAYILQENGYDTVEANEALGFEDDTRQYEE
AIAVLQTLRTKPVRLITNNPKKTDAISHAGLSLSGRIPLWGDVSEFNEKYLQTKINRSGH
MKADQEVRTIATS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacacacagatcttaaaacagccattttaaaagataaaatcaaacgagtacag
caagaagacgggtatatatatatcactggacccattaaattgccagtgaatttagacggc
agaacagtgatgttcaactggtattcatggttaaaagacgatgggttagaaccattgtca
gatgaagctttaattgaaagcctctcgtcccgccagcttgccgatcatcagcagtcaagc
gtgctagtgtatggagatttcgagcacgctgacgaagcccttatccgcatgcattccatt
tgccacactggtgatattttcggaagcaagcgctgcgattgcggcttccaattgaagcag
tccatgcgaatgattgaggacaatggtgcaggtgccctgttttatttagccaaccatgaa
ggccgcggtattggacttttcacgaaagccatggcttatatccttcaagaaaacggctac
gatacagtagaagcgaacgaagcacttggctttgaagatgacacgcgtcaatatgaagag
gccatcgcggttcttcaaacacttcgtacaaagccagttagactcattaccaataatccg
aaaaagacagacgccatcagccatgcaggtctttctctttctggacggattccactttgg
ggtgatgtctctgagttcaatgaaaaatacttacagacaaaaattaaccgctcaggtcat
atgaaggcggatcaagaggtgcgtacgattgccacatcatga

DBGET integrated database retrieval system