KEGG   Bacillus pumilus SAFR-032: BPUM_3693Help
Entry
BPUM_3693         CDS       T00599                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu00230  Purine metabolism
bpu00250  Alanine, aspartate and glutamate metabolism
bpu01100  Metabolic pathways
Module
bpu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BPUM_3693
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPUM_3693
Enzymes [BR:bpu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BPUM_3693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ABV64337
UniProt: A8FJC0
Position
complement(3660545..3661834)
Genome map
AA seq 429 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIKFDGVTYKLHLIPSGIF
YKEKTCVIGNGMVVDPKALVTELAYLHERNVSTDNLRISNRAHVILPYHLKLDEVEEERK
GANKIGTTKKGIGPAYMDKAARIGIRVADLLDREVFEEKLARNLEEKNRLLEKMYEAEGF
KIEDILDEYYEYGQQVKKYVVDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPTKIQHVVGVSKAYTTRVGDGPFPTELHDEIGDQIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYKLNGEITEEFPASL
NELAKCEPVYEEMPGWTEDITGVKNLSELPENARHYLERISQLTGIPLSIFSVGPDRSQT
NVVRSVYRP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtagtcgtagtaggtacgcagtggggtgacgaagggaaagggaaaattacc
gatttcctttcagaaaatgcagaggtgattgcccgttatcaagggggaaacaatgcaggt
cacacgatcaaatttgatggagtgacttacaagctacacctcattccgtccggtattttt
tataaagagaaaacttgtgtcatcggtaatggaatggtagttgatcctaaagcgttggtc
actgagcttgcgtatcttcacgaacggaatgtgagtacagataacctcagaatcagcaat
agagcccatgtgattttaccttaccatttaaaattggacgaggtagaagaagagcggaaa
ggggctaacaagatcggtacgacgaaaaaaggaatcggaccagcttatatggacaaagca
gctcgtatcggtatccgtgtcgcagatctattagatcgtgaagtatttgaagagaagctt
gctcgtaatctagaagagaaaaatcgtcttttagagaaaatgtacgaagcagaaggcttc
aagattgaagatattttagatgagtattatgaatatggccagcaagtgaaaaaatatgtc
gtagatacatctgttgtcttgaatgacgcactagatgaaggccgccgcgtgctatttgaa
ggtgcacaaggtgttatgcttgatatcgatcaagggacatatccatttgttacgtcatct
aacccagtggctgggggagtgacgattggttctggtgtaggaccaacgaagattcaacat
gtggtcggcgtgtcaaaagcgtacacaacacgtgttggagatggcccattcccgacagaa
ctccatgatgaaattggtgatcaaatccgtgaggttggccgtgaatacggtacaacaact
ggacgcccgcgccgtgttggctggtttgacagtgttgttgtccgccatgctcgtcgtgtg
agcgggattacagatctatctcttaactcaattgatgtactgacagggattgaaacattg
aaaatctgtgtcgcttataaattgaacggagaaatcacagaagaattcccagcaagtcta
aatgaactagcgaaatgtgagcctgtctacgaagaaatgccaggatggacagaggatatt
acaggcgtgaagaatttaagcgaactgcctgaaaatgcccgtcattatttagagcgcatt
tcacaattaacaggtattccactttccattttctcagtcggaccagatcgttctcaaacg
aatgttgtccgcagcgtgtaccgtccataa

DBGET integrated database retrieval system