KEGG   Bacillus pumilus SAFR-032: BPUM_3695Help
Entry
BPUM_3695         CDS       T00599                                 

Definition
(GenBank) cytochrome
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: ABV64339
UniProt: A8FJC2
Position
3662769..3663974
Genome map
AA seq 401 aa AA seqDB search
METTSPSAVQKTLLRGKNKQDPYHPFDWYANMRKTSPVHFDEASRTWSVFTYEEARRVTI
DKDTFSSQPPKNQRKHSLMKTMVMMDPPNHTRIRSIVSKAFTPRVMKLWEPRIHELMDEL
MAQLEGKKEIDLVQDISYPLPVIVIAELLGVPSEHKQSFKEWSDILVSMPKSESEKDVAE
WQKTRDKGEADMMAFFADTIEKKRHNLGDDLISLIIQAEENGDKLSADELIPFCNLLLLA
GNETTTNLISNMMFSLLEQPGAYEALAQSPELIPRAVEEAVRFRAPAPAIVRYVTKDTEL
GEKVLKRGDNVIVFLASANRDERQFSNAHEYDIHRHPNPHIGFGHGIHFCLGAPLARLEA
CTAIKIFIERYEALELLSYVPMTSSSMYGLKELKLRVTPRS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacgtccccaagtgccgtgcaaaaaacgttattaagaggaaaaaacaagcag
gacccgtatcacccatttgattggtatgccaacatgcgcaagacatcacctgttcatttt
gacgaagccagccgaacgtggagtgtattcacctacgaggaagcaaggcgcgtgacaatc
gataaagataccttttcgagtcagcctcctaaaaaccagcggaagcattcactgatgaaa
acaatggtgatgatggaccctcccaatcacactcgcatccgctccattgtcagcaaagcc
tttacccctcgagtcatgaaattgtgggagcctcgtattcatgaattaatggatgaactg
atggcacaacttgaaggaaaaaaagagattgacctagtgcaagacatttcctatccgctt
cctgtcattgtcattgcagagcttttaggtgtgccctcagagcataaacaatcttttaaa
gaatggtcagatattctcgtcagcatgcctaaaagtgaaagtgagaaggatgtagctgaa
tggcagaaaacacgtgacaaaggggaagctgacatgatggcattttttgcagacaccatt
gaaaagaaacgtcacaaccttggtgatgatttaatttccctcatcattcaagcggaggag
aatggagacaaactgtcagcagatgaactcattccattttgtaatcttcttcttttagcc
ggcaacgaaacaaccaccaacttgatctccaatatgatgttcagcttgttagaacagcct
ggtgcgtatgaagcgctcgcccaatctcctgaactcatcccacgtgcggtggaagaggct
gtccgttttcgtgcaccagctcctgcgattgttcgttatgtcacaaaagatacagaactt
ggagagaaagtgttgaaaaggggcgacaatgtgattgtgtttcttgcttccgccaaccga
gatgagcgtcaattttcaaacgcacatgaatacgatatacaccgccatcctaatcctcat
attggtttcgggcacggtatccatttctgccttggcgcaccactagcacgtcttgaagca
tgtacagctataaagattttcatagaacgatatgaggcgctagagctcctttcttatgtt
ccgatgacaagcagcagcatgtatggactgaaagagctgaaactgcgtgtcacacctcgt
tcataa

DBGET integrated database retrieval system