KEGG   Bacillus pumilus SAFR-032: BPUM_3697Help
Entry
BPUM_3697         CDS       T00599                                 

Definition
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BPUM_3697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bpu03032]
    BPUM_3697
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BPUM_3697
DNA replication proteins [BR:bpu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BPUM_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase AAA FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ABV64341
UniProt: A8FJC4
Position
complement(3664548..3665912)
Genome map
AA seq 454 aa AA seqDB search
MTELLDDRLPPQNIEAEQAVLGAVFLEPSALTLASEVLIPEDFYRMSHQKIYNAMLVLGD
RGEPVDLVTVTSELANTDLLEEVGGISYLTDIANSVPTAANIEYYAKIVEEKSILRRLIR
TATTIAQDGYTREDEVEDLLSDAEKTIMEVAQRKNSGAFQNIKDVLVQTYDNIEQLHNRK
GDITGIPTGFSELDRMTAGFQRNDLIIVAARPSVGKTAFALNIAQNVATKTDESVAIFSL
EMGSEQLVMRMLCAEGNINAQNLRTGNLTEEDWGKLTMAMGSLSNSGIFIDDTPGIRVSE
IRSKCRRLKQENGLGMILIDYLQLIQGSGRSSDNRQQEVSEISRALKSLARELEVPVIAL
SQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYDKESENKNIIEIIIAKQR
NGPVGTVSLAFVKEYNKFVNLERRFDDAGVPPGA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacttctcgatgaccggctgccgccgcaaaatatagaagccgagcaggccgta
ttaggtgctgtttttttagaaccatctgcgctcacgctcgcttctgaggtattaattcca
gaggatttctatagaatgtcgcatcaaaagatttataatgcgatgcttgtacttggtgat
agaggggaaccggtcgatcttgttacggtgacatctgaactggccaatacagatttacta
gaagaggtaggcgggatttcgtatttaaccgatattgcgaactctgtcccaactgccgca
aacatagaatactatgcaaaaattgtagaagagaaatccattttaagacgtctgatccgc
acggcgacaaccattgcacaggatggatacacgcgtgaggatgaagtagaggatctgttg
agtgatgctgaaaagaccattatggaagtggcgcagcgtaaaaactcaggagctttccaa
aacattaaggacgtgcttgttcagacatatgataatattgaacagcttcataaccgaaaa
ggcgatatcacagggattccaacaggtttctccgagcttgatcggatgacagctggattc
cagcgaaatgacttaattattgtagcagctcgtccatcagtagggaaaacggctttcgca
ttgaacatcgcacagaatgttgcgaccaaaacggacgaaagtgtcgccatctttagttta
gagatgggatctgagcagctagttatgcgtatgctatgtgctgaggggaatatcaatgca
caaaacctaagaaccggtaatctgacagaagaggactggggcaagctgacaatggcaatg
ggctcgctatctaatagtgggattttcattgatgatacaccaggaatcagagtaagtgaa
attcgctcaaaatgccgccgcttgaagcaagaaaacggtcttggaatgatcttgattgac
tacttacagcttattcaagggagcggacgatcaagcgataaccgtcagcaagaggtttct
gaaatctctcgggcattaaaatcgctggcaagggagcttgaagttccagttattgctttg
tctcagctttcacgtggagtagagcagcgtcaggacaaacgtccgatgatgtctgatatt
cgtgaatcaggaagtatcgagcaggatgccgatatcgtggcattcctttatcgtgatgat
tactacgataaagaatcagagaataagaacattattgaaatcatcattgccaaacagcgt
aacggcccagtgggtacagtatcactggcgttcgtcaaagaatataacaaattcgtcaac
ctggaaagaaggtttgacgatgcgggtgttccgcccggtgcttaa

DBGET integrated database retrieval system