KEGG   Bacillus pumilus SAFR-032: BPUM_3701Help
Entry
BPUM_3701         CDS       T00599                                 

Definition
(GenBank) iron-uptake system-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu02010  ABC transporters
Module
bpu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BPUM_3701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpu02000]
    BPUM_3701
Transporters [BR:bpu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BPUM_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 EzrA DUF2031 DUF3328
Motif
Other DBs
NCBI-ProteinID: ABV64345
UniProt: A8FJC8
Position
3670117..3671088
Genome map
AA seq 323 aa AA seqDB search
MKKWAAFLFICMVMIITSACGNGDQTTATTKKTTSTETPAKAEIEYLGKTYEVNTPAKRL
VIAGSLESMEDAKLLGIHPIGASTVGGTFPSLFEDITSKTEGIGEKTEPNAEKILKLKPD
VILGSTKFPPATIQKLAKIQTTIPVSHISSDWKANLILLGQLTGKETEVKTIIANYQKDL
EKAKKTLKETSKNKTAIILRIRQGDLYVYPEDVYFNSTLYGDLGFTAPNEVKKAKAQSLL
SLERLGELDPDYIFIQFSEEENASNPKALKDLESNQIWASLQAVKQGHVSENIVDPLLQG
GTALSKTTFLEQAVNWLSSKKTE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatgggcagcttttcttttcatttgtatggtcatgattatcacttcagcttgt
ggcaatggagatcaaacaacggctacaacaaagaaaacaacctccacggaaacaccagct
aaggctgaaatagagtatttaggaaagacatatgaagtcaacacaccagcaaaacgactt
gtcattgctggaagcttagaatcaatggaagatgccaaactgcttggtattcacccaatt
ggtgcttcaacagtaggcggcacattcccatcattatttgaagacatcacgtctaaaaca
gaaggcattggtgagaaaacagaaccaaacgcagaaaaaattctgaagctcaaacctgat
gtcattttagggtcaacaaagttcccgccagcgaccattcaaaaactagcgaagattcaa
acaaccattccagtgtctcatatttcttccgattggaaagccaatctcatattgcttgga
caattgactgggaaagaaacagaagtaaaaacgatcattgcaaactatcaaaaagactta
gaaaaagcgaaaaaaacattaaaagaaacaagtaaaaacaaaacagccatcatcctccgc
attcgacaaggagatctttacgtctatcctgaagatgtatatttcaactctaccttgtat
ggagatcttggatttactgcaccaaacgaagtaaaaaaggccaaagcacaatccttactt
tcattggaacggctcggcgaattggaccctgattatatttttattcaattctctgaggaa
gaaaacgcttcaaatccgaaagccctcaaggatttagagtccaatcagatttgggcaagc
cttcaagcagtgaaacaagggcatgtgagtgaaaatatcgtcgatcccctgcttcaaggt
gggacagctttaagtaaaaccacatttctcgaacaagcagtcaattggttatcatcaaaa
aaaactgaatga

DBGET integrated database retrieval system