KEGG   Bacillus pumilus SAFR-032: BPUM_3702Help
Entry
BPUM_3702         CDS       T00599                                 

Definition
(GenBank) esterase
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase
Motif
Other DBs
NCBI-ProteinID: ABV64346
UniProt: A8FJC9
Position
3671135..3671866
Genome map
AA seq 243 aa AA seqDB search
MKGTFLYEELNGRQLDIYLPPHSNTLMPAVIVQDGSSLFHQHILSLEEMIEGRSIMPVVL
IGIHPINRLDEYTPWEAPSLHSSFPAFKGEADTYLAFLTDQLMPYLVQYYPVEPDDRQHA
LIGASLGGLVSMYALWKKQSFFQHIGSLSGSFWYPHFMPYVRQHHPKALPQRIYLSVGSE
EGKEKSSAQQHMVPFTEELHHILHGYGMPKHQLRLHIEYREGHHISQFQRNFVSALKWFY
GAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtacttttttatatgaggaactgaacggacggcaactcgatatttatctcccg
cctcattcaaacaccctcatgccggctgtgattgtccaggatggttcttccctgtttcat
cagcacatcctttctttagaagagatgatcgaaggccgttccatcatgcctgtggtactg
attggcattcacccaatcaaccggctcgatgaatatacaccttgggaggcaccctctctt
cattcatccttcccagctttcaaaggtgaagcagacacgtatctcgcttttttaactgac
cagttgatgccttatcttgttcaatactatccggttgagcctgatgatcgtcagcacgca
cttattggtgcctccttaggtggccttgtgtccatgtatgcactttggaagaagcaatcc
ttttttcaacatatcggctctctttccggttccttttggtatcctcacttcatgccttat
gtacgtcaacatcaccctaaggctttaccccagcgcatttatttatccgttggcagtgag
gaaggaaaggagaaatcttctgctcagcaacatatggtgccatttacggaagagctgcat
cacattctgcacggttatggtatgccaaaacaccaactccgccttcatattgagtacagg
gagggacatcatatcagtcaatttcagcgaaactttgtctctgccctcaagtggttttat
ggcgctaaatag

DBGET integrated database retrieval system