KEGG   Bacillus pumilus SAFR-032: BPUM_3704Help
Entry
BPUM_3704         CDS       T00599                                 

Definition
(GenBank) transporter
  KO
K03449  MFS transporter, CP family, cyanate transporter
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpu02000]
    BPUM_3704
Transporters [BR:bpu02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    BPUM_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF485
Motif
Other DBs
NCBI-ProteinID: ABV64348
UniProt: A8FJD1
Position
3672125..3673333
Genome map
AA seq 402 aa AA seqDB search
MEQQLEQSTLHPRSKGQTILLIAGILLIAFNLRPAITSVGPLIGAIRSDLQLSNGLAGFL
TTLPLLSFALLSPITPKIGKRLGNERTLWLGLAVLLFGIVIRSFGSITFLMIGTALIGVG
IAICNVLLPGLVKHKFPAHAGLMTSVYTTSMSVFAALASGVSVPLSHAMPGGWNTSFLVW
AGLALLAMMVWAPQLLHQNTAAVKSISLTEQPIWRSRVAWQVTLFMGLQSFLFYSSIAWF
PDILTSHGMNLSTAGWMLSIMQFVGLPSTFLAPVFAEKLKTQRPLVFGLVLVYLLGMIGL
LLGGSTPILVISVLLIGIGQGASISLALTFIGLRTTNMEQAAALSGMAQSIGYLLAAVGP
LMIGILFDVTHTWTPSIIIFIIVLFFMFLSGMRAGRSVYISD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaactagaacaatcaaccttacatccccgcagtaaaggacaaaccatcctg
ctgattgctgggattttacttattgcatttaacctacgacctgccattacgtctgttggc
cctctcatcggtgccattcgttccgatttgcagttgtctaacggacttgcaggttttctt
acgacgttaccactgctctcattcgcattgctttctcccattacacctaaaatcggaaag
cgtctgggcaacgaacgaaccctttggctagggctcgctgtccttttgtttgggattgtg
attcgctcgtttggttccatcaccttcttaatgatcggaaccgcacttatcggtgtcggg
attgcgatatgtaatgtgctcttaccggggctcgtgaagcataaatttcctgcacatgct
ggtttaatgacaagtgtctatacgacctcgatgtccgtctttgcggcacttgcatcaggt
gtcagtgttccgctcagccatgcaatgcctggcggctggaatacatcattcctcgtatgg
gctggccttgcacttcttgcgatgatggtctgggctccgcagcttcttcatcagaacaca
gcggctgtcaaaagcatttcgctcacagagcagccaatatggcgttcacgtgtcgcatgg
caggtaactttatttatggggctgcagtcattccttttctatagcagcatcgcttggttt
cctgatatcttaacatcgcatggaatgaatctatcaacagccggttggatgctgtccatt
atgcagtttgttgggctgccatccacctttctagcacctgtttttgcagaaaaattaaaa
acacaaagaccgcttgtcttcgggcttgtccttgtgtatttacttgggatgatcggactt
cttctcggaggatcgacgcctattctggtgatctctgttttattgatcggtattggacaa
ggtgcaagcatcagtcttgccctcacatttatcggattacggacaaccaatatggagcaa
gccgctgcgctttctggaatggcgcagtctatcggttatttattagccgccgttggtcca
ctcatgatcggtatcctttttgatgtcacacatacatggacgccatccattatcatcttt
atcatcgttctatttttcatgtttttatccggtatgcgtgctggacgaagcgtctatatt
tcagattga

DBGET integrated database retrieval system