KEGG   Bacillus pumilus SAFR-032: BPUM_3707Help
Entry
BPUM_3707         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2232 5TM-5TMR_LYT Thia_YuaJ Caveolin DUF948
Motif
Other DBs
NCBI-ProteinID: ABV64351
UniProt: A8FJD4
Position
complement(3675835..3676791)
Genome map
AA seq 318 aa AA seqDB search
MDRGEGVKQTKALVEGAIMISIFSVMTLFYLYVPLLSIIFFLAAPIPIILYTIRHGLKKG
IAAGAIGIVISFLIGSINGLMTAPVLIAVGLGMGVFYSRRQPGNAIIAGGLIYLFSFLIS
FIVSVQLFQIDIMNIAKESIEQMMPMVESTLKQSGASEKEIAKQLKQFKELQDTALNALP
VALLITATLMAFVNHWFVRPLIKRFVSDMPVLKKFKDLRLPKSMVWYYLLTLLLMLIQTE
KGSFLWLVQSSAFKILFILVLIQGFSFIFYYCHEKGISKAVPIFAIVLGVLYPPVGVVVR
IIGIADIGFDLREKVKNK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttggatagaggtgaaggtgtgaaacaaacaaaagcgttagtagagggcgctatcatgatc
agtattttctctgtcatgacgctgttttatttgtatgtgccgctattatccattattttc
tttctagctgctccgattccgatcatcctctatacaatcaggcacggcttgaaaaaagga
attgctgctggcgctatcgggatagtgatcagctttttaattgggtctattaatggactc
atgactgcgcccgttctgattgctgtcggattaggcatgggtgttttctacagcagacgg
cagcccgggaatgccatcattgcaggtgggctgatttatttattcagttttcttatctcc
tttattgtcagtgttcagctttttcaaatcgatatcatgaatattgcgaaagagtcgatt
gagcaaatgatgccgatggtagagagtactttaaagcaatccggcgcgtctgaaaaggag
attgccaaacagctcaaacagtttaaagagttgcaggatacagcattaaacgctttacct
gtagcgcttttgatcactgctactttgatggcttttgtgaatcattggttcgtgcggccc
ttgatcaaacggtttgtatcagacatgccagtccttaagaaatttaaggatttgcggctg
ccaaaaagcatggtatggtattatttactcacactgcttttgatgctgattcagacagaa
aaaggcagctttttatggctcgttcaatcgagtgcgtttaaaattttatttatactggtg
cttattcagggattttcttttatcttctattattgccacgaaaaaggcatctcaaaagca
gtccccattttcgctatcgtgttaggggttctctatccgccagtcggtgtggttgtgcgt
atcatagggattgctgacataggctttgatttaagagaaaaagtgaaaaacaaataa

DBGET integrated database retrieval system