KEGG   Bacillus pumilus SAFR-032: BPUM_3711Help
Entry
BPUM_3711         CDS       T00599                                 

Definition
(GenBank) hypothetical protein
Organism
bpu  Bacillus pumilus SAFR-032
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race GNAT_acetyltr_2
Motif
Other DBs
NCBI-ProteinID: ABV64355
UniProt: A8FJD8
Position
complement(3679551..3680207)
Genome map
AA seq 218 aa AA seqDB search
MIRLHCLHAHPSNQSYIEDVFGDPDIELHHTVDSSFIERATQDPDFHPHKQQAYAINKLM
KEDEADIILLTCTQYIAALGDQEHLFKQPIVPIDEPLFELICQRKGPLQLVFSNPDTVEG
TMERLESYAKKHGKQMDAEVMVMEGVFHLCLNGDLHAYEEEIKKHLRRCMKKDGDICVMQ
LSMVHAAQQMVEETGVPIIHPLSPLKQYVHQTISALKE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgattcgattacactgccttcatgcccatccgtctaatcagtcttatatagaagacgtg
tttggtgatccagatattgagttgcatcacacggtcgattcatcatttatagaacgtgcc
acacaagatccagattttcatcctcacaagcaacaagcctatgccatcaacaaactgatg
aaagaagatgaagctgacatcattctgctcacgtgtacacaatacattgccgctttaggt
gatcaagagcatctctttaaacaaccaattgttccaatcgatgaaccgttatttgagctg
atttgtcagagaaaagggccgcttcaacttgtgttttcaaacccggatacagtggagggg
acaatggagcggcttgaatcatatgcaaaaaagcacggcaaacagatggatgcagaagtt
atggtgatggagggtgtctttcacctttgcctaaacggtgatttgcacgcttatgaggag
gaaattaaaaagcatctcagaagatgtatgaaaaaagatggggacatttgcgtgatgcag
ttatcgatggtccatgcagcacagcagatggtagaagagacaggtgttccgatcattcat
ccgctttctccacttaaacagtatgtccatcaaacaatatctgctttgaaagagtga

DBGET integrated database retrieval system