KEGG   Bacillus pumilus SAFR-032: BPUM_3718Help
Entry
BPUM_3718         CDS       T00599                                 

Definition
(GenBank) 30S ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu03010  Ribosome
Module
bpu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BPUM_3718
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpu03011]
    BPUM_3718
Ribosome [BR:bpu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BPUM_3718
  Bacteria
    BPUM_3718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-ProteinID: ABV64362
UniProt: A8FJE5
Position
complement(3687082..3687321)
Genome map
AA seq 79 aa AA seqDB search
MAGGRRGGRAKRRKVCFFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTSAKYQRKL
TLAIKKSRQMALLPYVTGE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtggacgcagaggcggtcgtgcgaaacgtcgtaaagtatgtttctttacttct
aacggtatcacgcacatcgattacaaagatgttgatcttcttagaaagtttgtttctgag
cgtggtaaaattttacctcgtcgtgtaacaggaactagcgctaagtatcaacgtaaattg
acattagcgattaaaaaatcacgtcaaatggcattacttccatacgttactggtgagtaa

DBGET integrated database retrieval system