KEGG   Bacillus pumilus SAFR-032: BPUM_3733Help
Entry
BPUM_3733         CDS       T00599                                 

Definition
(GenBank) tRNA modification GTPase
  KO
K03650  tRNA modification GTPase [EC:3.6.-.-]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpu03016]
    BPUM_3733
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     BPUM_3733
Transfer RNA biogenesis [BR:bpu03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BPUM_3733
 Prokaryotic Type
   Methyltransferases
    BPUM_3733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MnmE_helical TrmE_N MMR_HSR1 FeoB_N Dynamin_N RsgA_GTPase AIG1 Ras GTP_EFTU MMR_HSR1_Xtn Roc AAA_16 AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABV64377
UniProt: A8FJG0
Position
complement(3700106..3701485)
Genome map
AA seq 459 aa AA seqDB search
MDTIAAISTPMGEGAIAIIRLSGPEAVQIADRMYKGPKEKKLVSVDSHTIHYGHIVDART
DQVIEEVMVSVLRAPKTFTREDVIEINCHGGIVTVNKVLQLALREGARLAEPGEFTKRAF
LNGRIDLSQAEAVMDLIRAKTDRAMNVAITQMEGRLSGLVQRLRGEILETLAHIEVNIDY
PEYDDVEEMTHRVLVEKATSVKKEIESLLSTSHQGKILREGLSTVIIGRPNVGKSSLLNS
LVQETKAIVTDIPGTTRDVIEEYVNVRGVPLRLVDTAGIRETEDIVERIGVERSRQVLKE
ADLILLVLNYSEELSEEDIKLFEAVSGMDIIVIVNKTDLEPKLDVEKVKQLAKDRPVVTT
SLLQEKGIDELEMAIQSLFFTGSIESGDLTYVSNTRHIALLQAAKQSIEDALEGIEMDVP
IDIVQIDLTRCWEQLGEIIGDAVHESLIDQLFSQFCLGK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattgcagccatttcgacaccgatgggtgaaggagcaatcgcgattattcgt
ttaagtgggcctgaagcggtgcagatcgctgataggatgtataaaggacctaaggagaaa
aaacttgtatcagtggattctcataccatccattatggtcatattgtggatgcaagaact
gatcaagtaatagaagaggtcatggtgtcagtacttcgagcgccaaaaacatttacgaga
gaagacgttattgagattaactgccatggcggaattgtaacggtcaataaagtattgcag
cttgctttaagagaaggagcaagattagcggagccaggtgagttcacaaagcgtgctttc
ttaaatggaagaatagatctatcgcaagcagaggctgtcatggacttgattcgggcaaag
acggatcgggcgatgaatgtagcgatcactcaaatggagggacgtctctccggtttggtt
cagcgactgcgcggcgagatcctagaaacactggcgcatattgaagtcaatattgactac
cctgagtatgacgatgttgaagaaatgacacatcgcgtcttagtggaaaaagcgacatcg
gtcaaaaaagaaattgagtcgctactctcgacttctcaccaagggaaaattcttcgagag
ggcttatccactgtcattataggaaggccaaatgttggaaagtcttccttgttgaatagc
cttgtacaggaaacaaaggccattgtcacagatattcctggaactacgagagacgttatt
gaggaatatgtgaatgtacgaggcgtacctctccgtctagtcgatactgcgggtatacgt
gagacagaggacattgttgagcgtataggggttgaacgatctagacaggtcttaaaagaa
gctgacctgattttacttgtgctcaattatagcgaagaattatcggaagaagatattaaa
ctttttgaggctgtctcaggtatggatatcatcgtgattgtgaataagacagaccttgag
cctaagcttgatgtagaaaaggtcaagcagttagcaaaggatcgtccggtggtcactaca
tcattattacaagaaaagggcattgatgagcttgaaatggcaattcaatcactgttcttc
actggatcaattgaaagtggagatttaacgtatgtaagtaatacaaggcatattgctctt
cttcaggcagcaaaacaatcaattgaagatgcacttgaaggaattgaaatggatgtacca
atcgacattgttcaaatagatttaacacgctgctgggaacagctcggtgaaattatagga
gatgctgttcatgaaagcttgattgatcagttattctctcaattctgtttaggaaagtaa

DBGET integrated database retrieval system