KEGG   Bacillus pumilus SAFR-032: BPUM_3736Help
Entry
BPUM_3736         CDS       T00599                                 

Definition
(GenBank) ribonuclease P protein component
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
bpu  Bacillus pumilus SAFR-032
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpu03016]
    BPUM_3736
Enzymes [BR:bpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     BPUM_3736
Transfer RNA biogenesis [BR:bpu03016]
 Prokaryotic Type
  5'processing factors
   Ribonucrease P
    BPUM_3736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P RNase_E_G
Motif
Other DBs
NCBI-ProteinID: ABV64380
UniProt: A8FJG3
Position
complement(3703449..3703808)
Genome map
AA seq 119 aa AA seqDB search
MKKRNRLKKNEEFQKVFKKGQSMANRQFVIYQLDQPNQDELRLGLSVSKKIGNAVMRNRI
KRLIRQVFLEEGHKLKQEKDYIVIARKPASELTFEETKKSLQHLFRKSAVYQQQPKKSS
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgaaacaggctaaaaaaaaatgaagagtttcaaaaagtgtttaaaaaaggt
caatcaatggcgaatcgtcaattcgttatttaccagctggatcaaccaaatcaagatgaa
ctgcgtttaggattgtctgtgagtaagaagattggtaatgcagtgatgagaaatcgaatt
aaacgactgatccgtcaggtgtttttagaggaaggtcataagttaaagcaagaaaaagac
tacattgtcattgcgagaaaaccagcaagtgaattgacctttgaagaaacaaagaagtct
ctccaacatttatttagaaaatccgctgtttatcaacaacaaccgaaaaagtcttcgtaa

DBGET integrated database retrieval system