KEGG   Bacillus pumilus SAFR-032: BPUM_3737Help
Entry
BPUM_3737         CDS       T00599                                 

Gene name
rpmH
Definition
(GenBank) ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
bpu  Bacillus pumilus SAFR-032
Pathway
bpu03010  Ribosome
Module
bpu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bpu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BPUM_3737 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bpu03011]
    BPUM_3737 (rpmH)
Ribosome [BR:bpu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BPUM_3737 (rpmH)
  Bacteria
    BPUM_3737 (rpmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L34
Motif
Other DBs
NCBI-ProteinID: ABV64381
UniProt: A8FJG4
Position
complement(3703887..3704021)
Genome map
AA seq 44 aa AA seqDB search
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLKRRRSKGRKKLSA
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacgtttcaaccaaataaccgtaagcgtagtaaagttcatggcttccgcagc
cgtatgagttctaagaacggacgtctagttttaaagcgacgccgcagcaaaggtagaaaa
aaattatcagcttag

DBGET integrated database retrieval system