KEGG   Bacillus pumilus MTCC B6033: BW16_02220Help
Entry
BW16_02220        CDS       T03175                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00051  Fructose and mannose metabolism
bpum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BW16_02220
Enzymes [BR:bpum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BW16_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N CoatB
Motif
Other DBs
NCBI-ProteinID: AHL70300
UniProt: W8QIX1
Position
458760..459881
Genome map
AA seq 373 aa AA seqDB search
MKALHFGAGNIGRGFIGSLLKTSGFELVFTDVNEAVINELNERGEYTVELAAPGQKQEIV
GPVSAINSSQNPAALTEAIATANLITTAVGPAVLKIIASSIAEGLKRKKPDHIINIVACE
NMIGGSAHLKEAVFSHLTADEQAVISQTVGFPNAAVDRIVPIQHHEDILKVSVEPFFEWV
IDETGFIGDVPQIDGATFVRDLTPYIERKLFTVNTGHALAAYVGYQQGVKTIKEAVDTPD
IRQVVEGALHETGSYLIDAYGFRKEEHDAYIQKIIKRFENAFISDEVTRVARSPLRKLGA
DDRLIGPAKKIKQPVYLIKGIAAALAYDFAEDEEAVRLQALRKEKGIEGVLQEVCGLKPE
DDLYQDILKEIER
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacttcattttggagcagggaatatcggcagagggtttatcggatctttgtta
aagacatcgggctttgagcttgtctttaccgatgtgaatgaagcggtcatcaatgagctg
aatgaaagaggagaatacacggttgaactcgcagcaccagggcagaagcaagaaatcgtc
gggcccgtatcagcgatcaattcttcacaaaatccagcagcattaacagaggcgattgcc
acagccaatttgattacaacagctgttggaccagccgtattgaagatcattgcctcatcg
attgctgaaggattaaaacgaaaaaagccagaccatatcatcaacatcgtggcatgtgaa
aatatgattgggggaagtgctcatttaaaagaagcggtgttctctcatttaacagcagat
gagcaagcagtgatatcacaaaccgttggctttccaaacgctgcggttgaccgcattgtt
ccgattcagcaccatgaggatattctcaaagtgtcggttgaaccatttttcgagtgggtc
attgatgagacgggctttattggagatgttccgcaaattgacggagcgacctttgtccga
gatttgacgccgtatattgaacggaagcttttcaccgtcaatacaggacatgcactagcg
gcttatgtcgggtatcagcaaggcgtaaaaaccattaaagaagctgttgatacaccagac
attcgtcaagttgtcgaaggtgcccttcatgaaacgggcagttatttaattgacgcatat
ggcttccgaaaagaagaacatgatgcgtacattcaaaaaattatcaagcgatttgagaat
gcttttatctccgatgaagtgactcgtgtcgcacgctctcctcttagaaagctgggagca
gatgaccgtttaatcggtccagcgaaaaagatcaagcagccagtgtacttaatcaaaggg
atcgctgctgccttggcttacgactttgcagaagacgaagaagcggtccgcttgcaggca
ttaaggaaagaaaaaggcattgaaggtgtgcttcaagaggtatgtggactcaaacctgaa
gacgatctctatcaagacatcctcaaagaaatcgagcgataa

DBGET integrated database retrieval system