KEGG   Bacillus pumilus MTCC B6033: BW16_10535Help
Entry
BW16_10535        CDS       T03175                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00480  Glutathione metabolism
bpum00590  Arachidonic acid metabolism
bpum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BW16_10535
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BW16_10535
Enzymes [BR:bpum01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BW16_10535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF823
Motif
Other DBs
NCBI-ProteinID: AHL71797
UniProt: W8R0N3
Position
complement(2012651..2013133)
Genome map
AA seq 160 aa AA seqDB search
MSIYDIQVKTINGQEKSMADYKGKVLIIVNTASKCGLTPQFKQLQELYDQYHEKGLEILG
FPCNQFMNQEPEGEEAIQEFCSLNYGVTFPMFAKVDVNGDNAHPLFKYLTSHAKGVLGTK
TVKWNFTKFIVDQNGEVTERFSPKTPPKELESSIIALLEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgatattcaggtcaagaccattaacggtcaggaaaaatcaatggcagat
tacaaagggaaagtactgatcatcgtgaacacagcgagcaaatgtggactgacccctcaa
tttaaacaattacaagagttatacgatcaatatcatgaaaagggccttgaaattttagga
tttccgtgcaatcaatttatgaatcaagagccagaaggggaagaagcaattcaagaattc
tgttcgttaaactatggtgtgaccttcccgatgtttgcaaaagtagatgtcaatggtgac
aatgcgcatccgcttttcaaatacttaacgagtcatgcgaaaggtgtgcttggtacaaaa
acggtgaaatggaattttacaaaatttatcgttgaccaaaacggagaagtgactgaacga
ttttctcctaaaacaccaccgaaagaattagaaagctccattatcgctcttttggagaaa
taa

DBGET integrated database retrieval system