KEGG   Bacillus pumilus MTCC B6033: BW16_12755Help
Entry
BW16_12755        CDS       T03175                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BW16_12755
Enzymes [BR:bpum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BW16_12755
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BW16_12755
    1.1.1.-  
     BW16_12755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP F420_oxidored ADH_N_assoc ApbA
Motif
Other DBs
NCBI-ProteinID: AHL72214
UniProt: W8QPW8
Position
complement(2396683..2397723)
Genome map
AA seq 346 aa AA seqDB search
MKALRWHDQKDIRLEEIDEPTVAPGKVKLKVKWCGICGSDLHEYLGGPIFIPVNEPHPLT
KEKAPITLGHEFSGEIVEVGEGVSNYKVGDRVVVEPIFATHGHQGAYNLDENMGFLGLAG
GGGGFSEYVSVDEELLHLLPDEISYEQGALVEPSAVALYAVRSSKVQAGDTAAVFGCGPI
GLLVIEALKAAGATDIYAVELSKERQEKAKELGAIIVDPSQYEDVVQEIARRTNGGVDVS
FEVTGVPVVLKQAIQSTRISGETVIVSIWEKGAEIMPNDIVIKERTVKGIIGYRDVFPSV
LNLMRKGYFSADTLVTKKIKLDDVIEDGFHALINEKDQVKILVSAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactacgctggcacgatcaaaaggacattcgactagaggaaattgacgaacca
acagttgctccaggaaaagtgaaactgaaagtaaaatggtgcggcatttgcggtagtgat
ttacatgaatatttaggcggaccgatcttcattcctgtgaacgaacctcatccacttaca
aaagaaaaagcacccattacattgggacacgagttctctggtgaaattgtagaagttgga
gaaggcgtgagtaattacaaagtaggcgatcgagtggttgttgaacctatttttgcaact
cacgggcaccaaggtgcttacaacttagatgaaaacatgggcttcttaggacttgctggt
ggcggtggaggattctctgaatatgtatctgtcgatgaagaattacttcatttgttacca
gacgaaatttcatatgagcaaggtgcacttgttgaaccttctgcagttgctttatatgcc
gttcgttctagtaaagtacaagctggggatacagcagctgtgtttggctgtggaccaatc
ggtttacttgtcattgaagcattaaaagcagctggtgctactgacatttatgcagtggaa
ttatcaaaagagcgccaagaaaaagcaaaagaacttggagcgatcattgtagatccttct
cagtatgaagatgttgttcaagaaatcgcacgccgtacaaatggtggagtcgatgtttct
tttgaagtgactggtgtacctgttgtattgaagcaagcaatccaatcaactagaatttca
ggtgaaacagtcattgtaagcatttgggaaaaaggcgcagaaattatgccgaatgacatt
gtcattaaagaacgtacagtcaaaggaatcatcggctacagagatgttttcccatctgta
ttaaacttaatgagaaaaggctatttctctgcagacacactcgtcacgaaaaaaatcaag
ctggacgatgtgatcgaagatggcttccatgcattaatcaatgaaaaagatcaagtgaaa
attttagtcagtgctgaataa

DBGET integrated database retrieval system