KEGG   Bacillus pumilus MTCC B6033: BW16_17880Help
Entry
BW16_17880        CDS       T03175                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpum  Bacillus pumilus MTCC B6033
Pathway
bpum00071  Fatty acid degradation
bpum00280  Valine, leucine and isoleucine degradation
bpum00310  Lysine degradation
bpum00362  Benzoate degradation
bpum00380  Tryptophan metabolism
bpum00620  Pyruvate metabolism
bpum00630  Glyoxylate and dicarboxylate metabolism
bpum00640  Propanoate metabolism
bpum00650  Butanoate metabolism
bpum00900  Terpenoid backbone biosynthesis
bpum01100  Metabolic pathways
bpum01110  Biosynthesis of secondary metabolites
bpum01120  Microbial metabolism in diverse environments
bpum01130  Biosynthesis of antibiotics
bpum01200  Carbon metabolism
bpum01212  Fatty acid metabolism
bpum02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW16_17880
   00630 Glyoxylate and dicarboxylate metabolism
    BW16_17880
   00640 Propanoate metabolism
    BW16_17880
   00650 Butanoate metabolism
    BW16_17880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BW16_17880
   00072 Synthesis and degradation of ketone bodies
    BW16_17880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW16_17880
   00310 Lysine degradation
    BW16_17880
   00380 Tryptophan metabolism
    BW16_17880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW16_17880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW16_17880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BW16_17880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpum04147]
    BW16_17880
Enzymes [BR:bpum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW16_17880
Exosome [BR:bpum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW16_17880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHL73166
UniProt: W8RME8
Position
complement(3380852..3382027)
Genome map
AA seq 391 aa AA seqDB search
MSTTVIVSGARTPFGKLGGTLSRLTAAELGGMTIKAALERASNVHEVDEVIMGSVLQGGQ
GQIPSRQAARHADLPWSVPTQTINKVCASGMRSVTTADQIIRAGDAKVIVAGGMESMSHA
PYLLKKARWGYKMGDGAVQDAMILDGLTCSFTGVHMGEYGSMAAKELGVTREEQDLWALR
SHERAIEAQKSGFFKNEIIPVTVKNKKGDQLISEDEAPRRDTSYERLSKLMPVFDQTGTI
TAGNAPGVNDGASALLLMKDTYAMQQGEKPLAVVLGHAQVAVEAKDFPKTPAYAIEKVLK
KTGKRVEDIDLFEINEAFSAVALACEKMLGLDRRKMNVNGGAVAIGHPIGASGTRIILTL
IHALRQRGGGIGIAAICSGGGQGDAIMIKVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgacggtcattgtatctggagcgagaacaccatttggaaaactaggtggaact
ttaagtcgtttgactgctgcagaattaggggggatgacgataaaagctgcgctggaaaga
gcctcaaatgttcatgaagtggatgaagtcatcatgggcagtgtccttcaaggaggacaa
ggtcaaattccttcaaggcaggcagctagacatgcagatcttccttggtcggttccgacg
caaaccatcaacaaagtctgtgcttcaggaatgcgcagtgtcacgacagccgatcaaatc
attcgagcgggagatgccaaggtgatcgtggcaggcggcatggaatccatgtcccatgct
ccttatcttctaaaaaaagcacgatggggttacaaaatgggagatggtgcagtacaagat
gccatgattttagatggattaacctgttcgtttacaggtgttcatatgggtgagtatgga
agcatggcggcgaaagagcttggcgtcacacgagaagaacaagacctttgggcgttaaga
agtcatgaacgagccattgaggcgcaaaaaagcggcttttttaaaaatgagatcatcccc
gttaccgtcaagaataaaaaaggagatcagctgatttcagaagatgaagccccgcggcgt
gatacgtcatatgaacgtttgtcaaaactgatgcccgttttcgatcagacaggtacgatc
accgctggcaatgcaccgggtgtcaatgatggtgcaagtgcgcttctattaatgaaagac
acatacgccatgcagcaaggtgaaaaacctctggcagttgtgcttggccatgcgcaagta
gcagtagaggcaaaggattttccgaaaacaccagcctatgccatcgaaaaagtgttaaag
aaaacagggaagcgagtagaggatatcgatttgtttgaaatcaatgaggctttttcagcg
gttgcattggcatgcgaaaaaatgcttgggctggatcggcggaaaatgaatgtgaacgga
ggggcagtcgcgattggtcacccgattggagcaagcggaacacgtattatattgaccttg
atccatgcactcagacaaagaggcggcgggatcggcattgcggcgatttgcagcggcggg
ggtcaaggtgatgcgatcatgatcaaggtagattaa

DBGET integrated database retrieval system