KEGG   Bacillus pumilus SH-B9: UP12_01500Help
Entry
UP12_01500        CDS       T04776                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00330  Arginine and proline metabolism
bpus00360  Phenylalanine metabolism
bpus00380  Tryptophan metabolism
bpus00627  Aminobenzoate degradation
bpus00643  Styrene degradation
bpus01100  Metabolic pathways
bpus01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    UP12_01500
   00360 Phenylalanine metabolism
    UP12_01500
   00380 Tryptophan metabolism
    UP12_01500
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UP12_01500
   00643 Styrene degradation
    UP12_01500
Enzymes [BR:bpus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     UP12_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Hrs_helical
Motif
Other DBs
NCBI-ProteinID: AMM99361
Position
270554..272035
Genome map
AA seq 493 aa AA seqDB search
MNVKEYMTYDATGLAALVRNKQVTPDELVQAAFARLNEVNPELNALIQTRQDQVLKEIKT
LHTNQPFAGVPFVLKNISQGLENEPLTAGAALLKDVKAKTDSHFVQRLKQAGFLMMGHTN
TPEFGLRNVTEPALHGPTRNPWHPDYSPGGSSGGTAAAVASGIVPAGGASDGGGSIRIPA
SFTGLFGLKPTRGRTPVGPGAGRQWQGASIDFTLTKTVRDSAALLDLLQVIQPEAAFQTP
LYDGSYQEDLVKRTSSMRIAYSVQSPVGTKVSEEAKQAVQQTVKWLSDQGHQVEEAGPAI
DGVHLMQQYYVMNSGEMSALFTSLARSLGRPVNPEETDIVAWVLAEAGKNVTAAAYTESL
DAWDMAAAQMASFHQTYDLFVTPATAYSAPKVGELMHSKEEITELLRVSSLSMQAQQDLI
YDMFLKSLTYTPFTQLANLTGQPSMSVPVHLTEEGMPLGVQVTAPKGKEDWLLRLAAEME
TSSIWKGTNQIIR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaagagtatatgacgtatgatgcgacaggcttggcagcacttgtacggaat
aagcaggtaacgccagacgagcttgtacaagctgcatttgctagattgaatgaggtcaat
cctgaattaaatgcgttgattcagacaagacaagatcaagtattaaaagaaatcaagaca
ttacatacgaatcagccgtttgcaggcgttccatttgtactgaaaaatatatcgcaaggg
ctggaaaatgaaccgctgacagcaggtgctgcattgttaaaggatgtaaaggcaaaaacg
gactcccactttgtccagcgattgaagcaggctggatttctcatgatggggcatacaaac
acaccagaattcggattaagaaatgtaacagaacctgctttacatggtccaacgaggaac
ccttggcatcctgactattcccctggcggttcaagcggcgggacggcagcagctgttgca
agcggcatcgtgcctgctggaggagcaagtgatggtggagggtcgattcggattccagca
tcctttacaggtttgtttggtctcaagccaacaagaggaagaacgccggtaggaccaggc
gcaggaaggcagtggcaaggggcatccattgactttacactcacaaaaacagtgcgggac
agtgcagcccttcttgatctgcttcaagtcattcagcctgaagcggctttccaaacgccg
ttatacgacggcagctatcaagaagatctagtgaaacgtacatcttctatgcgaattgct
tacagtgtacaatctccagttggtacgaaggtcagtgaggaagcgaagcaggcggtgcag
caaacagtgaaatggctgagtgatcaagggcaccaagtagaagaagcagggcctgcaatc
gatggggttcatctgatgcagcaatactacgtcatgaacagcggagaaatgtctgcatta
ttcacgtccttggctcgttcattaggacgtccagtcaatccggaggaaacagacatcgtg
gcatgggtgttggcggaggctggcaagaacgtaaccgctgctgcttacacagaaagtctt
gatgcatgggatatggcggctgcacaaatggcgtcatttcatcaaacttatgatctcttt
gtgacaccagcgacagcctattcagctcctaaggttggtgagttgatgcattcgaaggaa
gaaatcactgaacttttacgtgtgtcatctctctcaatgcaagcgcagcaggatctcatt
tatgacatgttcttaaagagtttgacctacacaccatttacacagcttgccaacttaacg
ggtcagccttctatgagcgttcctgttcatctcactgaggagggcatgcctttaggtgtc
caggttacagcacctaaggggaaagaggattggctgcttcggcttgcagcagaaatggag
acatcctcgatttggaaaggaacaaatcaaatcatacgttga

DBGET integrated database retrieval system