KEGG   Bacillus pumilus SH-B9: UP12_07840Help
Entry
UP12_07840        CDS       T04776                                 

Definition
(GenBank) succinyl-CoA synthetase subsunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00020  Citrate cycle (TCA cycle)
bpus00640  Propanoate metabolism
bpus00660  C5-Branched dibasic acid metabolism
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
bpus01120  Microbial metabolism in diverse environments
bpus01130  Biosynthesis of antibiotics
bpus01200  Carbon metabolism
Module
bpus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UP12_07840
   00640 Propanoate metabolism
    UP12_07840
   00660 C5-Branched dibasic acid metabolism
    UP12_07840
Enzymes [BR:bpus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     UP12_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AMM97259
UniProt: A0A063Z353
Position
1594158..1595060
Genome map
AA seq 300 aa AA seqDB search
MSVFINKNTRVIVQGITGSTALFHTKQMIEYGTNIVGGVTPGKGGTEVEGVPVFNTVSEA
VQTTGANASVIYVPAPFAADAILEAVDAEVDLVICITEHIPVLDMVKVKRYMEGKKTRLV
GPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTAVGIGG
DPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANMTKPVVGFIGGKTAP
PGKRMGHAGAIISGGKGTADEKVKTMRECGIEVAETPSVMGETLIKVLKEKNLFEACKTH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttattaataaaaatacgagagtaattgtgcaggggattaccggttcaacc
gcattgttccatacaaaacaaatgattgagtacggaacaaatattgttggcggtgtcaca
cctggaaaaggtggaactgaagtagaaggagttcctgtatttaatacagtatctgaagct
gttcaaacaactggagcaaatgcttctgttatctatgtaccagcaccatttgcagcagat
gccattttagaggctgttgatgcagaagtcgatctagtcatttgtattactgaacatatt
ccagtacttgacatggtcaaagtaaaacggtatatggaagggaaaaagacaagacttgtt
ggccctaactgtccaggtgtcattacacctgaagaatgtaagattgggatcatgccaggc
tacattcataaaaaaggtcatgtgggtgttgtttctcgttctggaacgcttacatatgaa
gcggtacatcagctttcagaagctggcgttggtcaatcgacagctgtaggaatcggcgga
gaccctgtcaatgggacaaactttattgatgtattaaaagcattcaatgaagaccctgat
acacatgctgtcattatgatcggtgaaatcggcggtacggctgaagaagaagcagctgaa
tgggtaaaagcaaatatgacaaagccagttgttggctttattggcggtaaaacggcgcct
ccaggaaaacgcatgggacatgctggtgccattatttctggtggtaaaggaacagctgat
gaaaaagtaaaaacaatgcgtgaatgtggaattgaagtggcagagacaccatctgtcatg
ggagaaacattgattaaagtactaaaagagaagaatctttttgaagcttgtaaaacgcat
taa

DBGET integrated database retrieval system