KEGG   Bacillus pumilus SH-B9: UP12_11115Help
Entry
UP12_11115        CDS       T04776                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00260  Glycine, serine and threonine metabolism
bpus00630  Glyoxylate and dicarboxylate metabolism
bpus00670  One carbon pool by folate
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
bpus01130  Biosynthesis of antibiotics
bpus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    UP12_11115
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UP12_11115
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    UP12_11115
Enzymes [BR:bpus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     UP12_11115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AMM97868
Position
complement(2232334..2233431)
Genome map
AA seq 365 aa AA seqDB search
MLKRTPLFHAYETFGAKTIDFGGWELPVQFSSIKEEHEAVRTKAGLFDVSHMGEVEIKGQ
DALPFLQRLLTNDVSKLTNGKALYTAMCYEDGGTVDDLLVYQKEKNDYLLVINASNIEKD
VEWLLQHQEANDVLIQNVSDQIALLALQGPLAADIMKAVADEEVTSLKPFTFLSKAEVAQ
KEVLVSRTGYTGEDGFEIYCKSEDAVHIWSVLLKVGEPKGLIPCGLGARDTLRFEARLPL
YGQELTKEISPLEGGIGFAVKTDKEANFIGKEALKKQKEEGPKRKLVGIEMIDKGIPRTD
YPVFSGEKQIGVVTTGTQSPTLKKNVGLALIESSQAQLGTEIEVQVRKKRLKAKIVATPF
YKRAK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgaacaccgctttttcatgcgtatgaaacgtttggcgcaaaaaccattgac
ttcgggggctgggaattacctgtccaattttcttccattaaagaagagcacgaagctgtt
cgaacaaaggcagggctttttgatgtgtctcacatgggtgaggtggaaatcaaaggtcaa
gacgcccttccttttttacaaaggttattaaccaatgatgtgtcgaagctgacaaacggc
aaggcactatatacagccatgtgctatgaagatggcgggacagtggatgatctgctcgtc
tatcaaaaagaaaagaacgattatttgcttgtcattaatgcatcaaatatcgaaaaagat
gtggaatggctgcttcagcatcaagaggcgaacgacgtattgatccaaaatgtctctgat
caaatcgccttgctagcccttcaaggacctcttgccgctgacatcatgaaagctgtagcg
gatgaagaagtgacatcgctcaagccatttacatttttatcaaaagctgaggttgctcaa
aaagaggtgcttgtttcaagaacgggctacacaggggaagacggctttgaaatctactgc
aagtcagaagatgcggtccacatttggtcggttttattgaaagtaggcgagccaaaaggg
ttaataccgtgcgggctcggtgcgcgtgacaccttgagatttgaagcaagacttccgctt
tatggccaggagctgacaaaggagatctctccattagaaggcgggattggctttgcggtc
aaaacagataaagaagccaattttattggcaaagaagcgctcaagaagcaaaaagaagaa
gggccgaagcgaaagcttgtcggcattgaaatgatagataaagggattccgcgcacagac
tatccagtcttctcaggagaaaagcagattggagttgtcaccacaggcacacaatcccca
acattaaagaaaaatgtcgggcttgctttaatcgaatcttctcaggcgcagcttggaaca
gagatagaagtacaagttcgcaaaaaacgtctaaaagcaaaaatcgtcgcaacaccattt
tataaaagagccaaataa

DBGET integrated database retrieval system