KEGG   Bacillus pumilus SH-B9: UP12_12465Help
Entry
UP12_12465        CDS       T04776                                 

Definition
(GenBank) alanine-phosphoribitol ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00473  D-Alanine metabolism
bpus01100  Metabolic pathways
bpus01503  Cationic antimicrobial peptide (CAMP) resistance
bpus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UP12_12465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UP12_12465
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    UP12_12465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bpus01504]
    UP12_12465
Enzymes [BR:bpus01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     UP12_12465
Antimicrobial resistance genes [BR:bpus01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    UP12_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AMM98121
Position
complement(2498142..2499647)
Genome map
AA seq 501 aa AA seqDB search
MKLLHTIHEYQQTKPTQPAFVSQHASITYDELWQLSDQMAGAIDAVATDSAPVIVYGHME
PEMLISFLGSVKSGRPYIPVDISIPAERIVSIIESSKASLLICANEQNVLDVEEHIEVKS
AASLLALEKEAPPSSQWVQQDDVFYIIYTSGSTGKPKGVQVTANNLESFTEWMCRDFPIG
EGRTFLNQAPFSFDLSVMDLYPALQSGGTLYCLVKDLVNKPKDMFAALGQSDVEVWTSTP
SFVQMCLMDPSFTGELLPELKVFLFCGEALPVSVASALLERFPKAQVFNTYGPTEATVAI
TSIEVTQAILDQHDSLPVGYAKPDTDIVILDEEGKSLPDGEKGEIVIVGPSVTRGYLGEQ
ALTEKVFFEYEGRPAYRTGDAGVAQDGLITCHGRLDYQIKLHGYRMELEEIEYHVSETTY
VNACVIVPFQPNGHVEYLIAAIVPAAHSFEKEYQLTSAIKKEMADSLPAYMIPRKFVYLE
QLYMTPNGKVDRKRIAKEVLL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattacacacgattcatgaataccaacaaacgaaaccaacacagccagcattt
gtttctcaacatgcttcgatcacatatgatgagctttggcaactatcagaccaaatggct
ggtgcgatcgatgcggtcgcaacagatagtgcacctgtcattgtatacggtcatatggag
ccagagatgctgatttcttttttaggcagtgtgaaatcaggtagaccatacattccggtc
gacatttcaatccctgcagagcgtatcgtctcaattattgaaagctcaaaagccagtcta
ttgatttgtgcaaatgagcagaatgtactagatgtagaagagcacattgaagtgaagagt
gcggcatcgcttttagctcttgaaaaagaagcaccgccatcatcgcagtgggttcaacag
gatgatgtgttttacatcatttatacgtctggcagtaccggaaaaccgaaaggcgttcag
gtaacagccaataatttagaaagctttacagagtggatgtgtagagacttcccaattggt
gaggggcgcacgttcttaaatcaagcaccgttttcttttgacttatcagtgatggatttg
tatccagcgcttcaatcaggcggcacgctttactgtttagtgaaagatcttgtgaataag
ccgaaggatatgtttgcagcacttggtcaatctgacgttgaagtgtggacatcaacacct
tcctttgtgcaaatgtgcttaatggatccttcctttacaggggagcttttaccagagttg
aaagttttcttgttctgcggagaggcacttcctgtatctgtagcaagtgcactccttgag
cgttttccaaaggcgcaggtctttaatacgtatggtccgactgaagcaactgttgcgatt
acatcgattgaagtcactcaggccattcttgatcagcacgattctttaccagtcggctat
gcgaaaccggatacagatatcgtcattttagatgaagaaggcaagagtcttcctgatggt
gaaaaaggggaaattgtcatcgtagggccaagcgtcacgagaggctacttaggtgaacaa
gctttaacggagaaagtattttttgaatacgaagggcgccctgcataccgcacaggtgac
gcaggtgtggcgcaggatggtttgattacgtgccacggtcgtctggactatcaaattaaa
ctgcacggataccggatggagcttgaagaaattgaatatcatgtgagcgagacaacgtat
gtcaatgcttgtgtgattgtgccattccagccaaacggtcatgtggagtacttgattgca
gccattgttccagcggcacattcttttgaaaaagaatatcagctgacaagtgcaattaag
aaagaaatggcggattcactgcctgcgtacatgattccaagaaagtttgtctatcttgag
cagctatacatgacgccaaacgggaaggttgaccgtaaaagaatcgcgaaagaggttctt
ctatga

DBGET integrated database retrieval system