KEGG   Bacillus pumilus SH-B9: UP12_13745Help
Entry
UP12_13745        CDS       T04776                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00010  Glycolysis / Gluconeogenesis
bpus00020  Citrate cycle (TCA cycle)
bpus00620  Pyruvate metabolism
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
bpus01120  Microbial metabolism in diverse environments
bpus01130  Biosynthesis of antibiotics
bpus01200  Carbon metabolism
Module
bpus_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UP12_13745
   00020 Citrate cycle (TCA cycle)
    UP12_13745
   00620 Pyruvate metabolism
    UP12_13745
Enzymes [BR:bpus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     UP12_13745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_33 AAA_24 AAA_25
Motif
Other DBs
NCBI-ProteinID: AMM98361
UniProt: A0A429XHK0
Position
2749529..2751115
Genome map
AA seq 528 aa AA seqDB search
MNSVDLKEDLQSLLSLENTHQNLSVPKLVEKILARDEGVLTSTGAVRATTGAYTGRSPKD
KFIVKEESSEHKIDWGQVNQPISKEAFDRLYTKVVSYLKERDELFVFEGFAGADERYRMP
ITVVNEFAWHNLFAKQLFIRPDGSTPSSNEKPFTILSAPHFKADPETDGTNSETFIIVSF
EKRTILIGGTEYAGEMKKSIFSVMNYLLPEQDILSMHCSANVGQEGDVALFFGLSGTGKT
TLSASASRKLIGDDEHGWSGSGVFNIEGGCYAKCVNLSEEKEPQIYKAISFGSVLENVVL
DEETREADYDDTFFTENTRAAYPIEMIDNIVKPSIAGHPSAIVFLTADAFGVLPPISRLT
KEQAMYHFLSGYTSKLAGTERGVTSPETTFSTCFGSPFLPLPAHVYAEMLGKKIDEHGAK
VFLVNTGWTGGGYGTGKRMNLAHTRAMVQAAIEGDLDNAEMITDDIFGLHIPLHIPGVPD
EVLQPSKTWDDQEAYQEKAHFLANEFKKNFQKFSHAASDIEAKGGPLV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagtggatttaaaagaagatttgcagtcattgctctcattagaaaatacgcac
caaaatttatctgttccgaaacttgttgaaaagattttggcacgtgatgaaggcgtttta
acatcaacaggagctgtccgtgctacaacgggtgcctacacaggacgttcgcctaaagat
aaatttatcgtgaaagaagaaagctctgaacataaaattgattggggtcaagtcaaccag
ccgatttctaaagaagcatttgaccgtttatatacaaaagttgtgtcatacttaaaagaa
cgtgatgaactattcgtctttgaaggatttgccggcgcagatgaaagataccgtatgcca
attacagtggtaaacgaatttgcatggcacaatctctttgcaaaacagctattcatcaga
cctgacggatcaacaccttcttcaaacgaaaaacctttcaccatcttatctgcaccgcat
tttaaagcagatcctgaaacagatggcacaaactctgaaacgtttattatcgtttctttt
gaaaaacgcaccattctgatcggtggaacagaatatgctggagagatgaaaaagtccatt
ttctctgtcatgaactacctgcttcctgagcaagatattttatctatgcactgctcagca
aacgttggtcaagaaggcgatgtcgcactattcttcggcctttcaggtactgggaaaacg
acactttctgcaagcgcaagccgcaagctgatcggtgatgatgaacatggctggtctggc
tcaggagtcttcaatattgagggcggatgctatgcgaaatgtgtgaacttaagcgaagaa
aaagaaccgcaaatctacaaagccatcagcttcggatcagttcttgaaaatgttgtactt
gatgaagaaacacgtgaagcggattatgatgacacattctttactgaaaacacacgagct
gcttacccaatcgaaatgattgataacatcgtgaagccaagtatcgcaggacacccatct
gccattgtcttcttaacagctgatgcatttggcgttttacctccaatcagccgtttaaca
aaagaacaggcgatgtaccatttcttgagcggttacacaagtaaattagcaggaactgag
cgcggtgtcacatcaccagaaacgacattctctacttgcttcggttcaccattcttgccg
cttccagctcacgtctatgctgaaatgcttggcaagaaaattgatgagcacggcgctaaa
gtattccttgtgaatacaggctggactggcggaggctatggtacaggcaaacgtatgaac
ctagcgcatacaagagcaatggtgcaagcagcgatcgaaggcgacctcgacaacgccgaa
atgatcactgatgacatctttggattacacatcccgcttcatattcctggcgttccagat
gaagtgcttcaaccatctaaaacatgggatgaccaagaggcttatcaagaaaaagcacac
ttccttgccaatgaatttaaaaagaacttccaaaaattcagccacgcagcaagtgacatt
gaagccaaaggcggaccactcgtataa

DBGET integrated database retrieval system