KEGG   Bacillus pumilus SH-B9: UP12_15210Help
Entry
UP12_15210        CDS       T04776                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00627  Aminobenzoate degradation
bpus01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    UP12_15210
Enzymes [BR:bpus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     UP12_15210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Acid_phosphat_B Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AMM98616
Position
complement(2984923..2985693)
Genome map
AA seq 256 aa AA seqDB search
MKYKGYLIDLDGTMYKGTEKIEEAGQFVQKLNELNIPYLFVTNNSSRTPKQVAEKLVSFD
IPATEEQVFTTSMATANYIAEQKKDASVYVIGEEGIKQAIEEKGLTFGQEDADFVVVGID
RSITYEKFAVGAIAIRQGAQFVSTNGDIAIPTERGLLPGNGSLTSVLTVTTTVKPTFIGK
PESIIMEQAMRVLGTDVSETLMVGDNYDTDIMAGMNAGMDTLLVHTGVTTKELLQKYDKQ
PTYVIDSLSEWIERLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaggctatttaattgatttagacggaacaatgtataaaggaacagaaaag
atcgaagaagcaggtcaatttgttcaaaagttaaatgagctgaacattccctacttgttt
gtcacgaataactcgtcacgcacgccaaagcaggtagcggaaaaactcgtttcattcgat
atcccagcaacagaagaacaagtctttacaacaagtatggcaacagccaactatattgcc
gaacaaaagaaagacgcgtctgtttacgtcatcggtgaagaaggaatcaagcaggccatt
gaagaaaaagggctgacgtttggtcaggaggacgctgatttcgtagttgttggaattgat
cgcagcattacatatgaaaaattcgcagtaggtgcgattgccatccgtcaaggcgcacaa
tttgtctcaacaaatggagacattgccattccaactgaaagagggcttctgccagggaac
ggctcgttaacatctgtattgaccgtgaccactaccgtcaagccaacatttatcgggaag
ccagaatcgatcatcatggaacaagccatgcgggtgctcgggactgatgtgtccgagacg
ctcatggtgggtgataactatgatacagatattatggcagggatgaatgcaggaatggac
acattgctcgttcatacaggcgtgacaacaaaagagctgcttcagaaatatgataaacag
ccaacctatgtcattgattcattatcagagtggattgagcgattatcataa

DBGET integrated database retrieval system