KEGG   Bacillus pumilus SH-B9: UP12_17395Help
Entry
UP12_17395        CDS       T04776                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00071  Fatty acid degradation
bpus00072  Synthesis and degradation of ketone bodies
bpus00280  Valine, leucine and isoleucine degradation
bpus00310  Lysine degradation
bpus00362  Benzoate degradation
bpus00380  Tryptophan metabolism
bpus00620  Pyruvate metabolism
bpus00630  Glyoxylate and dicarboxylate metabolism
bpus00640  Propanoate metabolism
bpus00650  Butanoate metabolism
bpus00900  Terpenoid backbone biosynthesis
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
bpus01120  Microbial metabolism in diverse environments
bpus01130  Biosynthesis of antibiotics
bpus01200  Carbon metabolism
bpus01212  Fatty acid metabolism
bpus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpus00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UP12_17395
   00630 Glyoxylate and dicarboxylate metabolism
    UP12_17395
   00640 Propanoate metabolism
    UP12_17395
   00650 Butanoate metabolism
    UP12_17395
  Lipid metabolism
   00071 Fatty acid degradation
    UP12_17395
   00072 Synthesis and degradation of ketone bodies
    UP12_17395
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UP12_17395
   00310 Lysine degradation
    UP12_17395
   00380 Tryptophan metabolism
    UP12_17395
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UP12_17395
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UP12_17395
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    UP12_17395
Enzymes [BR:bpus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UP12_17395
Exosome [BR:bpus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UP12_17395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMM99020
Position
complement(3427282..3428457)
Genome map
AA seq 391 aa AA seqDB search
MSKTVIVSGARTPFGKLGGAFSGLTAAELGGVAIKAALERVPGSHHVDEVIMGSVLQGGQ
GQIPSRQAARHADLPWSVPTQTINKVCASGMRSVSTADQIIRAGDAEVIVAGGMESMSHA
PYLLKKARWGYKMGDGAVQDAMILDGLTCSFTGVHMGEYGSMAAKELGITREEQDLWALR
SHERAIEAQKNGFFQHEITPVTVKTKTGERLMTEDESPRRDTSYERLSKLMPVFDQTGTI
TAGNAPGVNDGASALLLMKDTYAEQHDVKPLVVVLGHTQVAVEAKDFPKTPAFAIEKILQ
KTGKRLEDIDLFEINEAFSAVALACEKITGLDRRKMNINGGAVALGHPIGASGTRIILTL
IHALKQRGGGIGIAAICSGGGQGDAIMIKVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagacagtcattgtatctggagcaagaacaccatttggaaaactaggcggtgct
ttcagtgggctgactgccgcagaactaggcggagtggcaatcaaggctgcgcttgaaaga
gtgccaggttcacatcatgtggatgaggtcatcatgggaagtgttttgcagggaggacaa
ggtcagattccttcaagacaagcagcaagacatgctgatcttccgtggtccgttccgacg
caaaccatcaataaagtctgtgcatcaggaatgcgcagtgtgagcacagcagatcaaatc
atccgagctggagatgctgaggtcattgtagcgggcggtatggaatccatgtcacacgcc
ccttatttgctaaaaaaagcgcgatggggctacaaaatgggagatggtgcggtacaagat
gcgatgattttagatggattaacctgttcatttacaggcgttcatatgggtgagtatggg
agcatggctgcgaaggagctcggtatcacgagggaagagcaagacctttgggcattaaga
agtcatgaacgggcgatcgaagcgcagaaaaacggctttttccagcatgaaatcaccccc
gttaccgtcaagacgaaaacgggagagcggctgatgacagaagatgaatctccgcggcgt
gatacgtcatatgaacggctgtcaaaactcatgcctgtgtttgatcaaacgggtaccatt
accgctgggaatgcaccaggtgtcaatgatggagcaagtgcgcttcttttaatgaaagac
acatatgcggagcagcatgacgtcaagccattggtagtcgtgcttggtcatacgcaggta
gctgtagaggcaaaggattttccgaaaacaccagcctttgctatcgagaaaattttacaa
aaaacaggcaagcgtctagaggatatcgatctatttgaaatcaatgaagccttctcagca
gtggcgctggcatgtgaaaaaataaccgggctggaccggcgcaaaatgaatatcaacggt
ggggcagtggcgcttggtcatcccattggggcaagcggaacacgtattatattgaccttg
attcatgcattgaaacaaagaggcggcggtattggcattgcggcgatttgcagtggaggc
ggtcaaggagatgccatcatgataaaggtagattaa

DBGET integrated database retrieval system