KEGG   Brucella pinnipedialis 6/566: DK65_1643Help
Entry
DK65_1643         CDS       T03261                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bpv  Brucella pinnipedialis 6/566
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DK65_1643
Enzymes [BR:bpv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DK65_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AIJ73930
Position
1:1667499..1668353
Genome map
AA seq 284 aa AA seqDB search
MSTFRAAAIQMRSGIDVVRNEEALEKLVADAAAQGAHYIQTPEMTGALMRDRPALFASVR
DEENDLVFRAARALAARHGVFLHIGSTAIDAGTGKIANRGGIFAPSGEKIATYDKIHMFD
VDLDNGESWRESAACEPGRQAVIAELPFAKVGMAICYDIRFPQLFQAQALAGANVITDPA
AFTRQTGEAHWHVLQRARAIENGAFLISAAQGGLHEDGRETYGHSIIVSPWGKVLAEAAH
DEPGVIVADIDLSESTAARAKVPNLKNAREFEVSLVCASQKEDA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctttcgcgctgccgcaatccagatgcgttcgggcattgatgtcgtccgcaat
gaggaggctctcgaaaaactggtcgcagatgcggcagcgcaaggcgcccattatatccag
acgccggaaatgaccggcgcgctgatgcgcgaccgtccggccctttttgcaagcgtgcgc
gatgaagagaacgacctggtcttccgggcggctcgcgcactggcggccaggcatggcgtc
ttcctgcatatcggttcgacggcaatcgatgcaggcaccggcaagatcgccaatcgcggc
gggatttttgcgccatcgggcgaaaagatcgccacttatgacaagattcatatgttcgat
gtcgatctcgacaatggcgaaagctggcgcgaatcggcggcctgtgagcccggcaggcaa
gccgtcatcgcggaactgcctttcgccaaagtgggcatggcgatctgctacgatatccgt
ttcccgcagctttttcaggcacaggcgctggctggcgcaaatgtcatcaccgaccctgct
gctttcacgcgccagactggtgaagcccattggcacgttctgcagcgcgcacgcgctatc
gagaatggcgcgttcctgatttccgcggcacagggcgggctgcatgaagatggccgtgaa
acctatggtcattcgattatcgtttcaccctggggcaaggtgctggcggaggctgcccat
gacgaacccggcgtgatcgttgccgatatcgacctgtcggaaagcacggcggcacgcgcc
aaggtgccgaacctgaagaatgcgcgggaatttgaggtgagcctcgtttgtgcgagccag
aaagaggatgcgtaa

DBGET integrated database retrieval system