KEGG   Brucella pinnipedialis 6/566: DK65_179Help
Entry
DK65_179          CDS       T03261                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00020  Citrate cycle (TCA cycle)
bpv00480  Glutathione metabolism
bpv01100  Metabolic pathways
bpv01110  Biosynthesis of secondary metabolites
bpv01120  Microbial metabolism in diverse environments
bpv01130  Biosynthesis of antibiotics
bpv01200  Carbon metabolism
bpv01210  2-Oxocarboxylic acid metabolism
bpv01230  Biosynthesis of amino acids
Module
bpv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DK65_179
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK65_179
Enzymes [BR:bpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DK65_179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIJ74370
Position
1:complement(169362..170576)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVANPVVELDGDEMTHIIWQFIKDKLIHPYLDIDLKYYDLSVENRDATNDQVTIDA
ANAIKEYGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYRATDFKFPGKGTLTIKFVGEDGQTIEHEVYQAPSAGVAMAM
YNLDESIREFARASFNYGLQRGYPVYLSTKNTILKAYDGRFKDIFQEVFDAEFKSKFEEK
KIWYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKT
VEAEAAHGTVTRHYRQHQKGEETSTNSIASIFAWTRGLAHRAKLDNNADLKKFAETLEKV
CVDTVESGFMTKDLALLIGPDQPWLSTTGFLDKIDENLQKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcaaggttgcaaacccggtcgtcgagctcgacggcgacgagatgacccac
attatctggcagttcatcaaggacaagcttatccatccctatctcgacatcgacctgaaa
tactacgatctttcggtcgagaaccgcgatgcgaccaatgatcaggtcacgatcgatgca
gccaatgccatcaaggaatatggcgtgggcgtaaaatgcgcgaccatcacgcccgacgaa
gcgcgcgtggaagaattcaagctgaagaaaatgtggaagtcgcccaacggcaccatccgc
aatatcctcggcggcgtgatcttccgcgagccgatcatctgcaagaacgtgccgcgcctc
gtgccgggctggacccagccgatcatcgtcggccgccatgctttcggcgaccagtaccgc
gcgactgacttcaagttccccggcaagggcacactgacgatcaagttcgtcggtgaagat
ggccagaccatcgaacatgaagtctatcaggccccttcggctggcgtggccatggccatg
tataatctggacgaatcgatccgcgaattcgcacgcgcttccttcaattacggcttgcag
cgcggctatccggtctatctctccacgaagaacaccatcctcaaggcctatgatggccgc
ttcaaggacatcttccaggaagtcttcgacgccgaattcaagtcgaagtttgaagaaaag
aagatctggtacgaacaccgcctcatcgacgacatggtcgcctcggcgctcaagtggtcg
ggcggctatgtctgggcctgtaagaactatgatggcgacgtgcagtcggatatcgtcgcg
cagggcttcggctcgctcggcctgatgacctcggttctgatgacgccggatggcaagacg
gtggaagcggaagccgcccacggcaccgtaacccgccactatcgccagcatcagaagggc
gaggaaacctcgaccaactccatcgcttcgatcttcgcatggacccgcggtctggcgcat
cgcgccaagctcgacaacaatgccgatctgaagaagttcgccgaaacgctggaaaaggtc
tgcgtggacaccgttgaaagcggcttcatgaccaaggatctggcgctcctcatcggcccg
gatcagccttggctctcgaccaccggcttcctcgacaagatcgacgaaaatcttcagaaa
gccatggctgcctga

DBGET integrated database retrieval system