KEGG   Brucella pinnipedialis 6/566: DK65_1880Help
Entry
DK65_1880         CDS       T03261                                 

Gene name
hdhA
Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    DK65_1880 (hdhA)
Enzymes [BR:bpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     DK65_1880 (hdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase 3HCDH_N T4SS-DNA_transf B12-binding
Motif
Other DBs
NCBI-ProteinID: AIJ74272
Position
1:complement(1915547..1916389)
Genome map
AA seq 280 aa AA seqDB search
MSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGG
KAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPFDMPMSDFEWAFKLNLF
SLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPM
GIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGERRISPMRRCSSVRPPQHGSA
VRFSRFPAAACRNSTDISLLRKQPIPTGIQSNFRRNSHGL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatgagagcccgttccacctgaatgatgctgttgcaatcgtcaccggagcggcg
gcaggtatcggacgggccatcgccggaaccttcgccaaggctggtgcttcggttgtcgta
accgaccttaaaagcgaaggcgctgaagccgttgcagccgcaataaggcaagctggcggc
aaggccatcgggcttgaatgcaacgtaaccgacgagcagcatcgcgaagccgtcatcaaa
gcggccctcgatcagttcggcaaaatcactgttctggtcaacaatgcgggtggaggcggc
cccaagcccttcgatatgccgatgagcgactttgaatgggccttcaagctcaatctcttt
tccctgtttcgcctgtcgcaattggctgccccacacatgcagaaggctggcggcggcgca
attctcaatatttcgtccatggccggagaaaataccaatgtccggatggcctcctatggt
tcgtccaaggcggcggtcaatcacctcacccgcaacattgccttcgatgtcggcccaatg
ggcattcgcgtgaatgccatcgcgcccggcgcgatcaagaccgatgcgctcgcaaccgtt
ctgacgcctgaaatcgaacgcgccatgctcaagcacacgccgcttggccgcctcggcgaa
cgcaggatatcgccaatgcggcgctgttcctctgttcgcccgccgcagcatggatcagcg
gtcaggttctcacggtttccggcggcggcgtgcaggaactcgactgacataagcctttta
cgaaagcagccgataccaacaggcattcaatccaatttcaggagaaacagccatggccta
tga

DBGET integrated database retrieval system