KEGG   Brucella pinnipedialis 6/566: DK65_2021Help
Entry
DK65_2021         CDS       T03261                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DK65_2021
Enzymes [BR:bpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     DK65_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: AIJ73735
Position
1:2063073..2063759
Genome map
AA seq 228 aa AA seqDB search
MKRSEINEIIRESDAFIRSFGYIMPPFAYWSPEELKQRTAGDVAAIRKARLGWDITDYGQ
GKFADLGLFLFTVRNGNAEDLKRGTGMLYAEKIMISRKNQLSPMHRHVVKAEDIINRGGG
TLVLELFNSRPDGSVDEETDVIVATDGRLVTQKAGAHLKLQPGESVTLLPGNWHAFWGEG
GDVLIGEVSTVNDDLTDNIFREPIGRFSDIEENEQPLHLLVSDYDKWL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctctgaaatcaatgaaatcatccgtgaaagcgatgcctttatccgctcgttc
ggttatatcatgccgccctttgcctattggtcgccggaagagctgaagcagcgcacggct
ggcgatgtggcggcgatccgcaaggcgcggcttggctgggatattaccgattacgggcag
ggcaagtttgccgatctcggcctgtttcttttcacggttcgcaatggcaatgccgaggac
ctgaagcgtggtacaggcatgctctatgccgaaaagatcatgatttcgcgtaaaaatcag
ctttcccccatgcatcgccatgtggtgaaggcggaagatatcatcaatcgcggtggcggg
acgctggtgctggaattgttcaattcgcggcctgatggcagcgtggacgaggaaaccgac
gtgattgtggcgaccgatgggcggcttgttacccagaaggcgggcgcgcatctgaagctc
cagcccggcgagagcgtaacgctcctgcccggcaattggcacgctttctggggtgagggc
ggcgatgtgctgatcggtgaggtttcgactgtcaatgacgatctgaccgacaatatcttc
cgcgagccgattggccgcttctcggatatcgaggaaaacgagcagcccttgcatctgctt
gtgtctgattacgacaagtggctatag

DBGET integrated database retrieval system