KEGG   Brucella pinnipedialis 6/566: DK65_2743Help
Entry
DK65_2743         CDS       T03261                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00010  Glycolysis / Gluconeogenesis
bpv00053  Ascorbate and aldarate metabolism
bpv00071  Fatty acid degradation
bpv00280  Valine, leucine and isoleucine degradation
bpv00310  Lysine degradation
bpv00330  Arginine and proline metabolism
bpv00340  Histidine metabolism
bpv00380  Tryptophan metabolism
bpv00410  beta-Alanine metabolism
bpv00561  Glycerolipid metabolism
bpv00620  Pyruvate metabolism
bpv00625  Chloroalkane and chloroalkene degradation
bpv00903  Limonene and pinene degradation
bpv01100  Metabolic pathways
bpv01110  Biosynthesis of secondary metabolites
bpv01120  Microbial metabolism in diverse environments
bpv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK65_2743
   00053 Ascorbate and aldarate metabolism
    DK65_2743
   00620 Pyruvate metabolism
    DK65_2743
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK65_2743
   00561 Glycerolipid metabolism
    DK65_2743
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK65_2743
   00310 Lysine degradation
    DK65_2743
   00330 Arginine and proline metabolism
    DK65_2743
   00340 Histidine metabolism
    DK65_2743
   00380 Tryptophan metabolism
    DK65_2743
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DK65_2743
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DK65_2743
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK65_2743
Enzymes [BR:bpv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DK65_2743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIJ73165
Position
2:complement(695852..697384)
Genome map
AA seq 510 aa AA seqDB search
MNTAVRKIDVKKEAADLLSKLGVDASAYTGGDLTGFSPVSGEEIASIKTHSKEDAEKIIA
KADEAFRAWRTVPAPKRGELIRLLGEELRASKEDLGRLVSLEAGKIPSEGLGEVQEMIDI
CDFAVGLSRQLYGLTIATERAGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALAIVCGN
AVVWKPSEKTLLTALACDAIFKRALKRFGDAPEGISQLLLGDREIGEVLVDSPKVPVVSA
TGSTRMGREVGPRLAKRFARAILELGGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTT
LRRLFVHESVYDALVPRLQKAYASVSVGSPLETSALVGPLIDKQAFDNMQKALKEAAAHG
GKVQGGERVDTGYENAYYVRPAIVEMPRQEGPVLEETFAPILYVMKYSDFDDVLASHNAV
GAGLSSSIFTLNLQEAERFLSAEDSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSD
AWKAYMHRATNTINYSKALPLAQGVSFDID
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgctgttagaaaaatcgacgtgaagaaggaagccgccgatctgctttccaaa
ctcggcgtcgacgcatccgcctataccggcggcgatcttaccggtttcagccccgtttcc
ggtgaagagatcgcttcgatcaagacccacagcaaggaagacgccgaaaagatcatcgcc
aaggccgatgaagccttccgcgcatggcgcaccgttcccgcgccaaagcgcggagagctg
atccgcctgctcggcgaagaactgcgcgcctccaaggaagacctcggccgtctcgtctcg
ctcgaagcaggcaagatcccgtcggaaggtctgggcgaagtgcaggaaatgatcgatatc
tgcgatttcgcagtcggtctgtcgcgccagctttacggcctcaccatcgccaccgaacgc
gccggccatcgcatgatggaaacctggcatccgctgggcgtcgtcggcgttatttccgcc
ttcaacttccccgtcgctgtctggtcatggaatgcggcgctcgccatcgtttgcggcaac
gcggttgtgtggaagccgtctgaaaagaccttgctcaccgcgcttgcctgcgatgcgatt
ttcaagcgcgcgctcaagcgtttcggcgatgcgccggaaggcatttcgcagctcctgctc
ggcgaccgtgaaatcggtgaagtcctcgttgacagcccgaaagttcccgttgtttcggca
accggctcgacccgcatgggccgcgaagtcggcccgcgcctggccaagcgttttgcgcgc
gcgatcctcgaactcggcggcaacaatgccggtatcgtctgcccgtcggccgatctggac
atggcactgcgcgcaatcgcttttggcgccatgggcaccgccggtcagcgctgcaccaca
ttgcgccgtcttttcgtgcacgaaagcgtttatgacgcactcgttccgcgtctccagaag
gcctatgccagcgtttcggtcggctcgccgcttgaaaccagcgctctggtcggcccgctg
atcgacaaacaagccttcgacaatatgcagaaggcgctgaaagaagcagccgcccatggc
ggcaaggtgcagggcggcgagcgcgtcgataccggatatgaaaacgcctattatgtgcgc
ccggctattgtcgaaatgccacgtcaggaaggcccggttctcgaagaaaccttcgcaccg
atcctttatgtgatgaaatattccgacttcgacgatgtgctggcgagccacaatgcggtc
ggcgcgggcctgtcatcctcgatcttcacgctgaatttgcaggaagcggaacgtttcctc
tccgcagaagattcggattgcggcatcgccaatgtcaatatcggcacgtcgggcgctgaa
atcggcggcgcattcggcggtgaaaaggaaaccggcggcggccgtgaatccggttcggat
gcatggaaggcctatatgcaccgtgcaaccaacaccatcaactactcgaaggccctgccg
cttgcacagggtgtttccttcgatatcgactga

DBGET integrated database retrieval system