KEGG   Brucella pinnipedialis 6/566: DK65_3171Help
Entry
DK65_3171         CDS       T03261                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpv  Brucella pinnipedialis 6/566
Pathway
bpv00071  Fatty acid degradation
bpv00072  Synthesis and degradation of ketone bodies
bpv00280  Valine, leucine and isoleucine degradation
bpv00310  Lysine degradation
bpv00362  Benzoate degradation
bpv00380  Tryptophan metabolism
bpv00620  Pyruvate metabolism
bpv00630  Glyoxylate and dicarboxylate metabolism
bpv00640  Propanoate metabolism
bpv00650  Butanoate metabolism
bpv00900  Terpenoid backbone biosynthesis
bpv01100  Metabolic pathways
bpv01110  Biosynthesis of secondary metabolites
bpv01120  Microbial metabolism in diverse environments
bpv01130  Biosynthesis of antibiotics
bpv01200  Carbon metabolism
bpv01212  Fatty acid metabolism
bpv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK65_3171
   00630 Glyoxylate and dicarboxylate metabolism
    DK65_3171
   00640 Propanoate metabolism
    DK65_3171
   00650 Butanoate metabolism
    DK65_3171
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK65_3171
   00072 Synthesis and degradation of ketone bodies
    DK65_3171
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK65_3171
   00310 Lysine degradation
    DK65_3171
   00380 Tryptophan metabolism
    DK65_3171
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK65_3171
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK65_3171
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK65_3171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpv04147]
    DK65_3171
Enzymes [BR:bpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK65_3171
Exosome [BR:bpv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK65_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ72969
Position
2:1153643..1154833
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgactttacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatcttgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system