KEGG   Brachyspira pilosicoli WesB: WESB_0287Help
Entry
WESB_0287         CDS       T02412                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00010  Glycolysis / Gluconeogenesis
bpw00030  Pentose phosphate pathway
bpw00051  Fructose and mannose metabolism
bpw00680  Methane metabolism
bpw01100  Metabolic pathways
bpw01110  Biosynthesis of secondary metabolites
bpw01120  Microbial metabolism in diverse environments
bpw01130  Biosynthesis of antibiotics
bpw01200  Carbon metabolism
Module
bpw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WESB_0287
   00030 Pentose phosphate pathway
    WESB_0287
   00051 Fructose and mannose metabolism
    WESB_0287
  Energy metabolism
   00680 Methane metabolism
    WESB_0287
Enzymes [BR:bpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     WESB_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2 Binary_toxB_3
Motif
Other DBs
NCBI-ProteinID: CCG55758
UniProt: K0JF34
Position
302893..304836
Genome map
AA seq 647 aa AA seqDB search
MKDKDYLELLSQKYPTIDDASVEIINLKAICKLPKGTEYFLSDIHGESEGFEYLIGTSSG
VIKEKIEILFRNTLTENERIELQILIVDTKNMINKKASKEDFNDWCRITIYRLIRICKLV
TSKYTRSKIRKKMPQNFAYILDELLQTSVEDNKENYYFSIIDSIIDVSASEKFIMALCAL
IRKCSIDRLHIVGDIYDRGPHPDKVIESIMNFNEVDMAWGNHDIHWLGAAKGSLICVANA
VRLAVRYNNFDLLEYSYGINLRALSSFANEVYKDDPCEVFKPNTLDKNIYDEVDKDLASK
MHKAISIIQFKLECQLIKRHPNYAMDERILLDKIDYKKGTINIDGKTYELKDKNFPTINP
KNPFELTEGENTLIQSLAFSFINSPTLQKHTNYIYAKGGIYKIFNGNLLYHGCIPTKEDG
SFDDVYIDGQYLSGKRYLKQVEDKVRKAFYCEVGSEEQLNALDYCWYLWCGPKSPLFGKN
KMTTFERYFIEDKETHKESYNSYYYHIDKKDYCESILKEFDLDIHKSHIVNGHVPVKTHK
GESPIKGGGILLVIDGGLSKAYHKSTGIGGYTLISNSNAMIIAEHRPFAEVVESGFRISP
KTTIVDRFVTRITVGETDIGIGLNKRISDLEELLNAYRNGIVKEKVN
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaggattatttagagttattatctcaaaagtaccccactatagatgatgct
tctgttgaaattattaatttaaaagctatatgcaaattgccaaagggtacagaatatttt
ttaagcgatatacatggagaatctgaaggctttgaatatttaataggcacttcatctggt
gttataaaagagaaaatagaaatattatttagaaatactttaacagaaaatgagagaata
gagcttcaaatacttatagtagatacaaagaatatgattaataaaaaagcatctaaagaa
gattttaatgattggtgcagaataactatatacagacttattagaatatgcaagcttgtt
actagtaaatatacaaggtcaaagattagaaagaagatgcctcagaactttgcttatata
cttgatgaacttttacaaacatctgttgaagacaataaagagaattattatttttctata
atagattctataatagatgtgtctgcatcagaaaagtttattatggcattatgtgctttg
ataagaaaatgcagtatagacaggcttcatattgtaggcgatatttatgacagaggacct
cacccagataaggtaattgagagtataatgaactttaatgaagttgacatggcttggggc
aatcatgatatacattggcttggtgctgctaaggggagtttaatttgtgttgctaatgct
gttcgtttggctgtgagatataataattttgatttgcttgaatatagttatggcataaat
ttaagggctttatcatcatttgctaatgaggtttataaagatgacccttgcgaagtgttt
aaacctaatactctagataaaaatatatatgatgaggttgataaagatttagcttcaaag
atgcataaggctatatcaataatacagtttaagttggaatgtcagcttataaaaagacac
ccaaattatgctatggacgaacgtatacttcttgataagattgattataaaaaaggcact
attaatattgacggtaaaacctatgagcttaaagataaaaactttccaacaataaatcct
aaaaacccttttgagcttacagaaggagaaaatactttaatacagagtttagctttttct
tttatcaatagcccaacacttcaaaagcatactaattatatttatgctaaaggcggaata
tataaaatatttaatggaaaccttctttatcatggatgcatacctacaaaagaagacggc
agttttgatgatgtatatatagatggacaatatttatctggaaagagatatttaaagcaa
gttgaagacaaggtacgtaaagcattttactgcgaagttggaagcgaagaacagcttaat
gctttggattattgctggtatttatggtgcggtccaaaatctccattattcggtaaaaat
aaaatgacaacttttgaaagatattttatagaagataaagaaactcataaagaaagttat
aattcatattattatcatatagacaaaaaagattattgcgagagcatattaaaagagttt
gatttggatatacataaatcgcatatagttaatgggcatgtacctgtaaagactcataaa
ggtgaaagcccaattaaaggcggtggaatacttttagtaatagacggaggactttctaag
gcctatcataaaagcacaggcataggaggctacactttaatatcaaactccaatgccatg
attatagcagagcatagaccttttgctgaagtagtggaatccggttttagaatatctccg
aaaacaactatagtagatagatttgtaactagaattacagtaggtgaaactgatattggt
attggcttaaacaaaagaataagtgatttggaagaattactcaatgcatatagaaacggt
atagtaaaagagaaggtgaattga

DBGET integrated database retrieval system