KEGG   Brachyspira pilosicoli WesB: WESB_0396Help
Entry
WESB_0396         CDS       T02412                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00260  Glycine, serine and threonine metabolism
bpw01100  Metabolic pathways
bpw01110  Biosynthesis of secondary metabolites
bpw01120  Microbial metabolism in diverse environments
bpw01130  Biosynthesis of antibiotics
bpw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WESB_0396
Enzymes [BR:bpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WESB_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CCG55867
UniProt: K0JGF8
Position
complement(409779..410807)
Genome map
AA seq 342 aa AA seqDB search
MRVYDLRTDTITKPSDEMRKAIYKAECGDDVYMEDPTVNKLQDMAAEITGKEKAIFVSSG
TMGNLIPLLILSSKTRQILLEEESHIVHYELGGVAALAGVLPLPVKAKRGILTKSIIEDY
FSPQPYYMSNVNIVEVENSHNRHGGSVYPIEVLKELYSFTKSKNVHMHMDGARVFNASIA
SKASVKEIASNTDSITFCLSKGLGAPMGAMLCGKKEFIDEAFKIRKLIGGGLRQIGLMAA
AGIYALENNIDSLEEDHIKAKKIASAVIESKLGELSLDEVETNIVIAKTQKKSIKLVNKL
LEKGIKASSFGDYKLRFVTHRDISMKEVEEACDIIKSFKNNI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagagtttatgatttaagaacagacacaataacaaagcctagcgatgaaatgcgtaaa
gcaatatataaagcagaatgcggcgatgatgtttatatggaagaccctacagtaaataaa
cttcaagacatggcagcagaaattacaggaaaagaaaaagcaatatttgtttcaagcggt
actatgggtaatttaatacctttattaatattatcttcaaaaacaagacaaatacttttg
gaagaagaatctcatattgtacattatgaacttggaggagtagctgcattggctggtgtt
ttgcctttgccagtaaaagctaaaagaggaatattaacaaaatctataatagaagattat
ttttctcctcagccttattatatgtctaatgtaaatatagtagaagttgaaaacagccat
aatagacatggaggaagcgtatacccaatagaggttttaaaagaattatatagttttaca
aaatcaaaaaacgtgcatatgcatatggacggagcgagagtatttaatgcttctattgct
tcaaaagcttcagtaaaagaaatagcttctaatacagattctatcacattttgtttgtca
aaaggactcggtgcacctatgggagctatgttatgcggaaaaaaagagtttatagatgag
gctttcaaaattagaaagttaataggaggaggattaagacagattggtttgatggctgct
gctggaatatatgctttagaaaataatatagactcattagaagaagaccatataaaggca
aaaaaaatagcttctgctgtaattgaatcaaaattgggtgagttgagtttagatgaagtt
gaaactaatattgttatagcaaaaacacaaaagaaatcaataaaattagtaaataaactt
ttggaaaaaggaataaaagcaagttcttttggtgattataaattaaggtttgtaactcat
agagatattagcatgaaagaagttgaagaagcttgtgatataataaaaagctttaaaaat
aatatttaa

DBGET integrated database retrieval system