KEGG   Brachyspira pilosicoli WesB: WESB_1094Help
Entry
WESB_1094         CDS       T02412                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00052  Galactose metabolism
bpw00561  Glycerolipid metabolism
bpw00600  Sphingolipid metabolism
bpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    WESB_1094
  Lipid metabolism
   00561 Glycerolipid metabolism
    WESB_1094
   00600 Sphingolipid metabolism
    WESB_1094
Enzymes [BR:bpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     WESB_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: CCG56563
UniProt: K0JFJ5
Position
complement(1193931..1195286)
Genome map
AA seq 451 aa AA seqDB search
MKFVLVGAGSAQFGCDMLGDIFSTKSLEGSHITLLDINNNALKKVYDYVREFIEANKLNF
SVDATTERKEAFKNTDFIISSIEVGDRFQLWDEDWKIPMQYGIHQVYGENGGAGGVFHSL
RIIPPILDIVKDAMDICPNAYIFNFSNPMTAICTAVKRAYPNAKFIGMCHEIGWLHKWLP
KILKKNYEDFEIKAGGLNHFSCLLEIKDKKTGKDLYPDVLKNAHGYFEHEVGYSDLLKYA
KTNNAFSKTESFDHSIEEKLKGEFIWADRRLLKVILEKYNLLPITVDSHFGEYIGWAWDV
VDHRGILDFYELYRTVLSKAEPKIELRVKERASSIIDGIVTNNKYTEEAVNILNDGLIED
LPSWIAVEVPAEISKDGVKGVKLNNVPKGYLSLLRNYVSVYDLTAEAAIHHKKEYAIQAI
LANPVVNVCKNIEEMVDRMIDSQKPYLDYLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgttttagttggtgcaggaagtgcacaatttggatgcgatatgcttggagac
attttctccacaaaatcattagaaggctctcatataactttgcttgatattaacaataac
gccttaaaaaaggtatacgattatgtaagagagtttattgaggctaacaaattgaatttt
agtgttgatgctactacagaaagaaaagaggcatttaagaacactgattttattataagt
tctatagaagtgggagatagatttcaattatgggacgaagattggaaaatacctatgcaa
tatggcatacatcaagtttacggagaaaatggaggagctggaggagtatttcactctttg
agaattattccgcctattttggatatagtaaaagatgctatggacatatgtcctaatgct
tatatatttaatttttcaaaccctatgactgcaatatgtactgctgtaaaaagggcttat
cctaatgcaaaatttataggcatgtgccatgagataggctggcttcataaatggcttcca
aaaatactaaaaaagaattatgaggattttgaaataaaagctggcgggcttaaccatttc
agctgtttattagagataaaagataaaaagacaggaaaagatttatatcctgatgtatta
aaaaatgcacatggttattttgagcatgaagtaggctatagtgatttattaaaatacgct
aaaacaaataatgcattttcaaaaacagaaagttttgatcactctatagaagaaaaattg
aaaggtgagtttatatgggctgacagaagattattaaaagtgatattagaaaaatataat
cttttgcctataacagttgacagccatttcggtgaatatataggctgggcttgggacgtt
gttgatcatagaggtatattagacttttatgaattatacagaacagttctttcaaaggct
gagcctaaaatagaattaagagtaaaagagagagcttcaagcataatagatggtatagtt
acaaacaataaatacacagaagaagctgtaaatattttgaatgatggattaatagaagat
ttgcctagctggatagcagttgaagtacctgctgaaataagcaaagacggagttaaaggc
gtaaaattaaataatgttcctaaaggttatttatcacttttaagaaactatgtgagtgta
tatgatttaactgctgaggctgctatacatcataaaaaagaatatgctatacaggctata
cttgctaaccctgttgttaatgtatgtaaaaatattgaagagatggtggacagaatgata
gattctcaaaaaccatatttagattatttaaaataa

DBGET integrated database retrieval system