KEGG   Brachyspira pilosicoli WesB: WESB_2260Help
Entry
WESB_2260         CDS       T02412                                 

Definition
(GenBank) pyruvate oxireductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bpw  Brachyspira pilosicoli WesB
Pathway
bpw00010  Glycolysis / Gluconeogenesis
bpw00020  Citrate cycle (TCA cycle)
bpw00620  Pyruvate metabolism
bpw00640  Propanoate metabolism
bpw00650  Butanoate metabolism
bpw00680  Methane metabolism
bpw01100  Metabolic pathways
bpw01120  Microbial metabolism in diverse environments
bpw01130  Biosynthesis of antibiotics
bpw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WESB_2260
   00020 Citrate cycle (TCA cycle)
    WESB_2260
   00620 Pyruvate metabolism
    WESB_2260
   00640 Propanoate metabolism
    WESB_2260
   00650 Butanoate metabolism
    WESB_2260
  Energy metabolism
   00680 Methane metabolism
    WESB_2260
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WESB_2260
Enzymes [BR:bpw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WESB_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_21 Fer4_10 Fer4_17 Fer4_8 Fer4_4 BRCT Fer4_16 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CCG57722
UniProt: K0JKW3
Position
complement(2505110..2506141)
Genome map
AA seq 343 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKS
FVRFSETEVRVNSTVEEPHVVAVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCIDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAEL
VEPNIEAFRKGGSESVVKEFKADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDL
QVTRTGNIPVFNPANCIDCANCEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGC
LKCVRACPKGPYSGKFEKDQQALRIEVEANCDVDKLTYRRYKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggatttttcgagatccgtctcgaaagtatcggt
ggaatgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggt
ttctatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatct
tttgtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgta
gtggcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaa
gatgctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaa
ttacatggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaactt
ccttcacaagctgctaatactatcataatgggtgctatggttaatcagcttgattttata
gattctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaatta
gttgagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattc
aaagctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaa
aataaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagattta
caagttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgct
aactgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaa
gaccctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgt
ttaaaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcag
caggctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgt
tataaaaaataa

DBGET integrated database retrieval system