KEGG   Paraburkholderia phenoliruptrix: BUPH_00650Help
Entry
BUPH_00650        CDS       T02300                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00562  Inositol phosphate metabolism
bpx00564  Glycerophospholipid metabolism
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BUPH_00650
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BUPH_00650
   00565 Ether lipid metabolism
    BUPH_00650
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BUPH_00650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpx02042]
    BUPH_00650
Enzymes [BR:bpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BUPH_00650
Bacterial toxins [BR:bpx02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BUPH_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AFT88111
UniProt: K0DPI9
Position
2:complement(544288..545760)
Genome map
AA seq 490 aa AA seqDB search
MATPADPADPGRRKILAALAGSIALSACGGGGGGGSSGGSGSGAPQPVGTIPPDRANLAR
PALPDPATSGIDHVVLVTMENRSFDHLMGWVPNAETAQAGRTFKDAFGETHAPFALATNA
AYGYQACSFADPNHSYDAGRIHLANGAMNGFLLTPATSLTRGDLLPIGYFQSADLDFYRG
AVTQYTVCDYYMSGILADTYPNRVYLHSGETDRLSDTLDTSSLPTIWDRLDAKGISSTYY
FHDVPFTALYGTRYVGRSKLFSEFLTDAAAGTLPSFCMVDPSFGGEAQGTSNDDHPHADV
RNGQVLLGQIYDALRTSPNWSKTLMIIVYDEWGGFMEHVAPPVKPVSSAEAALGNDGRLG
FRVPCMLLGPRVRANYVSRYPFDPSSIHQLLAWRFGLDPLGVRASDSTTFNMAYALDFTD
PARTDAPAIAVTQGTFGSACSNISTATSGASGIAQLDKSQLVPNTAISAPGGRFAELRTK
ADALGFPAPK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacgccggccgatccggctgatccaggccgccgcaagattcttgccgcgcttgca
ggttccatcgcactgtcggcttgtgggggcggcggtggcggcggcagcagcggcggctcg
ggttcaggcgcgccgcagcccgtcggcacgattccgcccgaccgcgcgaatcttgcgcgc
cccgcgctgcctgatccggccacctcgggaatcgatcacgtggtgctggtcaccatggaa
aaccgctcgttcgaccacttgatgggctgggtgccgaacgccgaaactgcacaggccggc
cgaaccttcaaggatgcgttcggcgaaacgcacgctccctttgcgctcgcaacgaacgcc
gcgtatggctatcaggcatgctcgttcgccgaccccaatcattcgtacgacgctggacgc
attcatctcgccaatggcgccatgaacggcttcctgctgacacccgccacgagcctcacg
cgcggcgatctgctgccgatcggctatttccagtccgcggacctcgacttctatcgcggc
gcagtcacccagtacaccgtctgcgactactacatgagcggcattctcgccgacacctat
ccaaaccgcgtgtatctgcatagcggggaaacggaccgcctgtcggacacgctcgacacg
tcgtcgcttccgaccatctgggaccgcctcgacgcgaagggcatttcttcgacctattac
ttccacgacgtgccgtttaccgcgctgtacggcacgcgctatgtgggccgctccaagctt
ttctccgagtttctcaccgacgcagcggccggcaccttgccctcgttctgcatggtcgat
ccgagcttcggcggtgaggcgcagggcacgtcgaacgacgaccatcctcatgccgacgtc
cgcaacggccaggtgctgctcggtcagatctacgacgcgttgcgcacgagcccgaactgg
agcaagacgctgatgatcatcgtgtacgacgagtggggcggtttcatggaacacgtagcg
ccgccggtcaagccggtgtccagtgcggaagccgcgctcggcaacgacggccggctaggt
ttccgcgtaccgtgcatgctgcttggcccgcgcgtgcgcgccaactacgtgtcgcgctat
ccgttcgatcccagttccattcaccagttgctcgcctggcgcttcggcctcgatccgctt
ggcgtgcgtgcgagcgattcgacgacattcaatatggcatacgccctcgactttaccgat
cccgcgcgcaccgacgcgccggccattgcggtgactcaaggcacgttcggttctgcctgc
tccaatatctcgacggcgacgtcgggcgcgagcgggatcgcgcaactggacaagagtcag
ttggtgcccaatacggcgatcagtgcgccgggaggccgttttgcggagttgcggaccaaa
gcggacgcgttgggctttccagcgccaaaataa

DBGET integrated database retrieval system