KEGG   Paraburkholderia phenoliruptrix: BUPH_01700Help
Entry
BUPH_01700        CDS       T02300                                 

Definition
(GenBank) 4-hydroxythreoninee-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BUPH_01700
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     BUPH_01700
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     BUPH_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA SBD_N NBD_C
Motif
Other DBs
NCBI-ProteinID: AFT85275
UniProt: K0DKH9
Position
1:complement(1319072..1321426)
Genome map
AA seq 784 aa AA seqDB search
MSSPDTGSARLLIIGDDLSGTADCAVTCARHGLTSVVSFGPAPAMDAAQIDVLAIDTDTR
RQLPADAARANQQAWHAHSTGRRIYKKIDSTLRGNVAAEVAALASVAGMAVVAPAFPQAG
RTTRGARQFVFGTPVEESEVWRNEGIAGTADLQAMLGAAGLRVATIDLAAVREGAASLQA
RLSACLVEQWQAVVCDSETDADLACIAAASATLDGVFWVGSAGLAAPLIEVLAARQSEPE
TTNGSTHRPTPPARAFARCGGTAHPRGVMTVVGSMSSVSHRQVALLRGEAGDSLDLFDVD
AADLLDPVSPAALMLTTRVTHSLMRGRHVIVAVSQSRRAAVDDGAHIARQLAERLAPAAA
HAGALIATGGETARALLSAMKVNALRVIEEIETGVPLLAAAHAGRTLPVVTKAGGFGQPE
TLYRAWQRLAAMQQAVAQAPRQSSEEETMTYRPVIGITMGDAAGVGPEIIMKSLAHASVY
DGCRPLVIGDSKRLVDAGQRTGVTLSVRPIASPAEARFQYGEVDCIDLGLIPADLPYGKL
SAVAGDAAYQYIARTVELTSAGELDAICTAPLNKEALHAGGHIFPGHTEMLAHLTGIPEV
SMMLVAPKLRVIHVTTHIGLLDAIRRIEPGLVQRTIERAHETLVRAGIDEPRIGVCGINP
HAGENGLFGYGEEEEKIVPAVAVLRERGWDVEGPLPADTLFFRAGRGDFDVVVAMYHDQG
HGPVKVMGLEAGVNVTVGLPVIRTSVDHGTAFDIAGKGIADERSMLEALKQAEDLATRRA
VQTA
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcctgacacgggaagcgcgcggcttctcatcatcggcgacgatctgtcgggc
acggccgactgcgccgtgacctgcgcgcgtcatggcctgacgagcgtcgtgagtttcgga
ccggcgcccgccatggatgccgcgcagatcgacgtgctcgccatcgacacggacacgcgc
cgccagctgcccgccgacgccgcgcgcgccaaccagcaagcatggcatgcgcattcgacg
ggccggcgcatctacaagaagatcgactcgacactgcgcggcaacgtggccgccgaagtg
gcggcgctcgcgagcgtcgcgggcatggccgtggtggcgcccgcttttccgcaagccgga
cgcacgacgcgcggcgcgcggcaattcgtgttcggcacgccagtggaggagtccgaggta
tggcgcaacgaaggcatcgcgggcacggccgacctgcaggcgatgctcggcgcggctggt
ctgcgggtcgcgaccatcgatctcgccgccgtgcgcgaaggcgcggcatcgctgcaggcg
cgtctttctgcctgcctcgtcgagcaatggcaagccgtggtgtgcgacagcgaaacggat
gccgacctcgcctgcatcgccgcagcgtccgcgacgctcgacggcgtgttctgggtcggc
tcggcagggctcgccgcgccgctgatcgaggtgctcgcggctcgccagtcagaaccggaa
acgacaaacggatcgacgcaccgacccacgccgccggcgcgcgcgtttgcgcgctgcggc
ggcacggctcatccgcgtggcgtgatgaccgtggtcggcagcatgtcgagcgtttcgcat
cggcaggtggcgctgttgcgcggcgaggccggcgattcgctcgatctcttcgacgtcgac
gccgccgacctgctcgatcctgtgagcccggccgcactcatgctgaccacgcgtgtcacg
cactcgctgatgcgcggccgtcacgtaatcgtcgccgtgagccagtcgcgacgcgcggct
gtcgatgacggcgcgcacatcgcacggcagctcgccgaacgcctcgcgccggccgccgct
catgcgggcgcgctgatcgcgaccggcggcgagaccgcgcgtgccttgctgtcggccatg
aaggtgaatgcgttgcgcgtgatcgaagaaatcgaaaccggcgtgcccctgcttgccgcc
gcgcatgcgggccgcacattacccgttgtcaccaaggcgggcggcttcggccagcccgag
accctgtatcgcgcatggcaacggctcgccgccatgcagcaagcggtcgcgcaagcaccg
cgtcaatccagcgaagaggaaactatgacttaccgtcccgtaatcggcatcacgatgggc
gatgccgccggcgtgggcccggaaatcatcatgaagagcctcgcgcacgcgtccgtgtac
gacggctgccgtccgctcgtgatcggcgactcgaagcgcctcgtcgatgcaggccagcgc
accggcgtcacgctgagcgtgcggccgatcgcgtcgcccgccgaggcgcgctttcagtac
ggcgaagtcgactgcatcgacctcggactgatcccggcggatctgccctacggcaagctc
tcggctgtcgccggcgacgctgcgtatcagtacatcgcgcgcacggtggagctcacgtca
gccggcgaactcgacgccatctgcaccgcgccgctgaacaaggaagcgctgcatgcgggc
ggacatatcttcccgggtcacaccgaaatgctcgcgcatctcacgggcatccccgaagtg
tcgatgatgctcgtcgcgccgaagctgcgcgtgattcacgtcaccacgcacatcggcctg
ctcgacgcgattcgccgcatcgaaccgggactcgtgcagcgcacgatcgagcgcgcgcac
gaaaccctggtgcgcgcgggcatcgacgagccgcgcatcggcgtgtgcggcatcaatccg
cacgccggggaaaacggcctgttcggctacggcgaagaggaagagaagatcgtacccgcc
gtcgccgtgctgcgcgagcgcggctgggacgtcgaaggaccgctgcccgccgacacgctg
ttctttcgcgcgggacgcggcgacttcgacgtggtcgtcgccatgtatcacgatcagggc
cacggtcccgtcaaggtgatgggcctcgaagccggcgtgaacgtcacggtgggcctgccg
gtgatccgcacctcggtcgatcacggcaccgcattcgacattgcaggcaagggcatcgcg
gacgaacgcagcatgcttgaagcgttgaaacaggcagaagacctggccacgcgccgcgcc
gtgcagacggcctga

DBGET integrated database retrieval system