KEGG   Paraburkholderia phenoliruptrix: BUPH_01816Help
Entry
BUPH_01816        CDS       T02300                                 

Definition
(GenBank) histidine transport system permease protein
  KO
K10016  histidine transport system permease protein
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BUPH_01816
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpx02000]
    BUPH_01816
Transporters [BR:bpx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BUPH_01816
   Histidine transporter
    BUPH_01816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFT85387
UniProt: K0DKU2
Position
1:1486958..1487698
Genome map
AA seq 246 aa AA seqDB search
MSRLHPGTLKRTWMETRVVLYGFGPVLLAGTIQTVELSVLSLAAAVLLGLAGAAAKLSLN
RPLRALATGYTTLIRSVPDLVLMLLLFYSIQIAVNNLTDALDLPQFDIDPFVAGVLTLGF
IYGAYFTETFRGAFLAVPRGQLEAGSAYGMSGARVFARILFPQMMRFALPGIGNNWQVLV
KATALVSIIGLADVVKAAQDAGKSTFNMFFFILIAALIYLALTTVSNLALIWLERRYSIG
VRHAEL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctgcatccgggcaccctcaaacgaacctggatggagacacgcgtggtgcta
tacggctttggtccggtgttgctggccggcacgatccagaccgtcgagctgtcggtcctg
tcgctcgcggccgccgtgctgctcgggctggcgggcgcggcggcgaaactgtcccttaac
cggccgttgcgcgcgctcgccaccggctacacgaccttgatccgctcggtgcctgacctc
gtgctgatgctgctgctgttctacagcatccagatcgcggtcaataatctgaccgacgcg
ctcgatctgccgcagttcgacatcgacccgttcgtggccggcgtgctgacgctcggcttc
atttacggcgcctatttcaccgagacgttccgcggcgcattcctcgccgtgccgcgcggc
cagctcgaagcgggcagcgcctacggcatgagcggcgcgcgcgtgttcgcgcgcattctg
tttccgcagatgatgcgtttcgcgctgcccggcatcggcaacaactggcaagtgctcgtg
aaagcgacggcgctcgtgtcgatcatcggtctcgcggatgtcgtcaaggccgcgcaggac
gcgggcaaaagcaccttcaacatgttcttcttcatcctgatcgcggcgctcatttatctc
gcgctgacgaccgtttcgaatcttgcgctgatctggctggaacgccgctattcgatcggc
gtgcggcacgcggagctttaa

DBGET integrated database retrieval system