KEGG   Paraburkholderia phenoliruptrix: BUPH_02263Help
Entry
BUPH_02263        CDS       T02300                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00071  Fatty acid degradation
bpx00072  Synthesis and degradation of ketone bodies
bpx00280  Valine, leucine and isoleucine degradation
bpx00310  Lysine degradation
bpx00362  Benzoate degradation
bpx00380  Tryptophan metabolism
bpx00620  Pyruvate metabolism
bpx00630  Glyoxylate and dicarboxylate metabolism
bpx00640  Propanoate metabolism
bpx00650  Butanoate metabolism
bpx00900  Terpenoid backbone biosynthesis
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01120  Microbial metabolism in diverse environments
bpx01130  Biosynthesis of antibiotics
bpx01200  Carbon metabolism
bpx01212  Fatty acid metabolism
bpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUPH_02263
   00630 Glyoxylate and dicarboxylate metabolism
    BUPH_02263
   00640 Propanoate metabolism
    BUPH_02263
   00650 Butanoate metabolism
    BUPH_02263
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BUPH_02263
   00072 Synthesis and degradation of ketone bodies
    BUPH_02263
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BUPH_02263
   00310 Lysine degradation
    BUPH_02263
   00380 Tryptophan metabolism
    BUPH_02263
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUPH_02263
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BUPH_02263
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BUPH_02263
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpx04147]
    BUPH_02263
Enzymes [BR:bpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BUPH_02263
Exosome [BR:bpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BUPH_02263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFT85834
UniProt: K0DQV4
Position
1:complement(2035308..2036495)
Genome map
AA seq 395 aa AA seqDB search
MEMTDVVIVSAARTAVGKFGGSLAKIAAPELGATVVRAVLERAGVKPEQVSEVILGQVLT
AGSGQNPARQALIKAGLPTAVPGMTINKVCGSGLKAVMLAANAIIAGDADIVIAGGQENM
SAAPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGVTAENVAKEFDITREAQDAF
AALSQNKAEAAQKAGRFDDEIVPIEIPQRKGDPLRFATDEFVRHGVTAESLAGLKPAFSK
EGTVTAANASGLNDGAAAVLVMSAKKAEALGLTPLARIKAYANAGVDPKVMGMGPVPASK
RCLERAGWSVNDLDLMEINEAFAAQALAVHKQMGWDTSKINVNGGAIAIGHPIGASGCRI
LVTLLHEMQKRDAKKGLASLCIGGGMGVALAVERI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgactgatgttgtgatcgtatcggccgcccgcacggcagtgggcaaattcggc
gggtcgctggcgaagatcgccgcgcccgaactcggcgcgacggtggttcgcgcggtattg
gagcgtgcgggcgtgaagcccgagcaggtgagcgaagtgatcctcgggcaggtgctgacg
gcgggctcgggccagaacccggcgcgccaggcgttgatcaaggcgggtctgcccacagcg
gtgcccggcatgacgatcaacaaggtctgcggctcgggcctgaaagcggtcatgctggcg
gccaacgcgatcatcgcgggcgacgcggacatcgtgatcgccggcggccaggaaaacatg
agcgcggcgccgcacgtgctgcccggttcgcgcgacggcttccgcatgggcgacgcgaaa
ctggtcgacaccatgatcgtcgacggcctgtgggacgtgtacaaccagtatcacatgggc
gtgacggcggaaaacgtcgcgaaggaattcgacatcacgcgcgaggcgcaggacgcgttc
gcggcgctgtcgcagaacaaggcggaagccgcgcagaaggcgggccgtttcgacgacgaa
atcgtgccgatcgaaattccgcaacgcaagggcgacccgctgcgcttcgccaccgacgaa
ttcgtgcgtcacggcgtgacggccgagtcgctggcggggctgaagccagcgttctcgaag
gaaggcacggtgacggcggccaatgcgtcgggcctgaacgacggcgcggcggcagtgctc
gtcatgtccgcgaagaaggcggaagcgctcggcctcacgccgcttgcgcgcatcaaggcg
tacgcgaacgcgggcgtcgatccgaaagtgatgggcatgggcccggtgccggcgtccaaa
cgctgtctggagcgcgcgggctggagcgtgaacgacctcgacctgatggaaatcaacgag
gcgttcgccgcgcaggcgctcgccgtgcacaagcagatgggctgggacacgtcgaagatc
aacgtgaacggcggcgccattgcgatcggccatccgatcggcgcgtcgggctgccggatt
ctcgtcacgctgctgcacgaaatgcagaagcgcgacgcgaagaagggcctggcttcgctg
tgcatcggcggcggcatgggcgtcgcgctcgcggtcgagcgcatttga

DBGET integrated database retrieval system