KEGG   Paraburkholderia phenoliruptrix: BUPH_02728Help
Entry
BUPH_02728        CDS       T02300                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00900  Terpenoid backbone biosynthesis
bpx01100  Metabolic pathways
bpx01110  Biosynthesis of secondary metabolites
bpx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BUPH_02728
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BUPH_02728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFT86311
UniProt: K0DJZ0
Position
1:complement(2608264..2609469)
Genome map
AA seq 401 aa AA seqDB search
MHKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFRPEVAVVGDA
DTAARVAAKLRDAGCKTEVTHGAEALVQVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKEALVMSGAIFMDAVHDNGAVLLPVDSEHNAIFQCLPREAALHGGVSKIILTASG
GPFRTREPATLVDVTPEEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWLFGLPGERID
VLIHPQSVIHSLVSYADGSVLAQLGNPDMRTPIAHALAFPDRVDSGVAQLDLAEIASLSF
EKPDYARFPCLALAMKALAEGGVASAALNAANEIAVEAFLSRQIGFMAIAQVVDSVLNAL
PNRSAHALEDVIEADAAARRAAAEFIARLPDAARRTERAVQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaacgtctgacattgctcggttccacgggctcgattggagacagcacgctcgac
gtcgtcgcgcgtcatccggagcgcttttcggtgtatgcgctcaccgcgcaccgcaacggc
gacaagctcgtcgagcaatgcctgcgcttccggcccgaagtcgcggtggtcggcgacgcc
gacacggccgcgcgggtcgcggcaaagctgcgcgacgcgggctgcaagacggaggtgacg
catggcgccgaggcgctcgttcaggtctcgaagagcgacggctgcgacaccgtggtcgcg
gcaatcgtcggcgccgccggcctcgcgccgagcctcgccgccgcgcgcgccggcaagcgc
atcctgctcgcgaacaaggaagcgctcgtcatgtcgggcgcgatcttcatggacgcggtc
cacgacaacggcgcggttctgctgccggtcgacagcgaacacaacgccattttccagtgc
ctgccgcgcgaagccgcgctgcatggcggcgtctccaagatcattctgaccgcgtcgggc
ggcccgtttcgcacgcgcgaaccggccacgctcgtcgacgtgacgccggaagaggcctgc
aagcatccgaactgggtcatgggccgcaagatttcggtcgattccgccaccatgatgaac
aagggcctcgaagtgatcgaggcgcattggctgttcggtctgccgggcgaacgaatcgac
gtcctgattcatccgcaaagcgtgatccattcgctcgtgtcctatgccgatggctcggtg
cttgcgcaactcggcaatccggacatgcgcacgccgatcgcccatgcgctcgcgttcccg
gatcgcgtggattccggggtcgcgcagctggacctcgcggaaatcgcgtcgctgtcgttt
gaaaaaccggattacgcgcgattcccttgcctcgcattggccatgaaggcgctcgccgaa
ggcggcgtcgccagcgcggcgctgaacgccgctaacgaaattgctgttgaagcgttcctg
tcgcgccagatcggcttcatggccatcgcgcaggtggtcgactcggtgctcaacgcgttg
ccgaatcgcagcgcgcacgcgctcgaagacgtgatcgaagcggacgccgccgcgcgccgc
gccgctgccgaattcatcgcgcgtctgcccgacgccgcccgccgcacggaacgcgccgtc
cagtga

DBGET integrated database retrieval system