KEGG   Paraburkholderia phenoliruptrix: BUPH_03166Help
Entry
BUPH_03166        CDS       T02300                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bpx  Paraburkholderia phenoliruptrix
Pathway
bpx00670  One carbon pool by folate
bpx00790  Folate biosynthesis
bpx01100  Metabolic pathways
Module
bpx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BUPH_03166
   00670 One carbon pool by folate
    BUPH_03166
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BUPH_03166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AFT86740
UniProt: K0DP95
Position
1:3128255..3128755
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARANNGVIGRDNQLPWRLPEDLAFFKRTTMGAPIIMGRKTHESIGRPLPGRR
NIVVTRDATRRFQGCDAATTLDEALKLAAQDQAPEAFLIGGAQLYVEGLRLADKLIVTEI
SADFQGDATFPAVDPDEWEEVAHETHRADAPNDFDYAFVTYRRKSH
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctcactctgatcgtcgctcgcgccaacaacggcgtgatcggccgcgacaac
cagttgccctggcgacttcccgaagacctcgcttttttcaagcgcacgaccatgggcgcg
cccatcatcatggggcgcaagacgcacgagtcgatcggcaggccattgccgggacgccgc
aacattgtcgtgacgcgcgacgcgacgcggcgcttccagggctgcgacgccgccaccacg
ctcgacgaagcgctgaagctcgccgcccaggatcaggcacccgaagcgtttctgatcggc
ggcgcgcagttgtatgtggaaggactgcgtctggcggacaaactgatcgtcaccgagatt
tcggccgattttcagggcgacgcaacgttccccgcagtcgaccctgacgagtgggaagaa
gtcgcgcacgaaacgcaccgcgcggatgcgccgaacgatttcgactacgcgttcgtgacc
tacaggcgcaagagccactga

DBGET integrated database retrieval system